KEGG   Rattus norvegicus (rat): 24648
Entry
24648             CDS       T01003                                 

Gene name
Serpina1
Definition
(RefSeq) alpha-1-antiproteinase precursor
  KO
K03984  alpha-1-antitrypsin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24648 (Serpina1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24648 (Serpina1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24648 (Serpina1)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   24648 (Serpina1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24648 (Serpina1)
SSDB
Motif
Pfam: Serpin PEPcase DUF1266 LON_substr_bdg
Other DBs
NCBI-GeneID: 24648
NCBI-ProteinID: NP_071964
RGD: 3326
Ensembl: ENSRNOG00000032669
UniProt: P17475 A0A0G2JY31
Position
6
AA seq 411 aa
MAPSISRGLLLLAGLCCLAPSFLAEDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELV
HQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQT
LNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVE
KGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMN
RLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTR
SAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDE
RGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcaccctccatctcacgggggctcctgcttctggcaggcctgtgttgcctggccccc
agcttcctggctgaggatgcccaggaaaccgatacctcccagcaggaccagagtccaacc
taccgtaagatttcttcaaacctggcagactttgccttcagcctataccgggagctggtc
catcaatccaatacatccaacatcttcttctcccctatgagcatcaccacagccttcgcc
atgctctccctggggagcaagggtgacactcgcaaacagattctagagggcctggagttc
aacctcacacagatacctgaggctgacatccacaaggccttccatcacctcctccaaact
ctcaacaggccagacagtgagctgcagctgaacacaggcaatggcctctttgtcaacaag
aatctgaagctggtggagaagtttctggaagaggtcaagaacaattaccactcagaagcc
ttctctgtcaactttgccgactcagaagaggctaagaaagtaattaatgattatgtagag
aagggaacccaaggaaagatagttgatttgatgaaacagctggacgaagacacggttttt
gccctggtgaattacattttctttaaaggcaagtggaagaggccattcaatcctgagcac
actagggatgctgacttccacgtagacaagtccaccacggtgaaggtgcccatgatgaac
cgcctgggcatgtttgacatgcactattgcagcacactgtccagctgggtgctgatgatg
gattacctgggcaacgccactgccatcttcctcctgcccgatgatggcaagatgcagcat
ctggagcaaactctcaccaaggatctcatttcccggttcctgctaaacaggcaaacaagg
tcagccattctctacttccccaaactgtccatctctggaacctataacttgaagacactc
ctgagctcactgggcatcacccgggtcttcaacaatgatgctgatctctctggaatcaca
gaggatgcccccctgaagcttagccaggctgtgcataaggctgtgctgaccttagatgag
aggggaacagaggctgcaggagccactgtggtggaggccgtccccatgtctctgccccct
caagtgaagttcgaccaccctttcattttcatgatagttgaatcagaaactcagagcccc
ctctttgtgggaaaagtgatagatcccacacgttaa

DBGET integrated database retrieval system