KEGG   Rattus norvegicus (rat): 24649Help
Entry
24649             CDS       T01003                                 

Gene name
Pim1
Definition
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  Jak-STAT signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    24649 (Pim1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24649 (Pim1)
   05206 MicroRNAs in cancer
    24649 (Pim1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24649 (Pim1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24649 (Pim1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24649 (Pim1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     24649 (Pim1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   24649 (Pim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal APH Haspin_kinase Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 24649
NCBI-ProteinID: NP_058730
RGD: 3330
Ensembl: ENSRNOG00000000529
UniProt: P26794
Position
20p12
AA seq 313 aa AA seqDB search
MLLSKINSLAHLRAAPCNDLHANKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIVKGQVYFRQRVSSECQHLIRWCLSLRPSDRPSFEEIQNHPWMQDVLLPQATA
EIHLHSLSPSPSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgtccaagatcaactccctggcccacctgcgcgcagccccttgcaacgacctg
cacgccaacaagctggcgccgggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgttgggcagcggtggcttcggctcggtctactcgggcatccgcgtcgccgac
aacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggggaactg
cccaacggcacccgagtgcccatggaagtggtcctgctgaagaaggtgagctcgggcttc
tcgggcgtcattagacttctggactggttcgagaggcccgatagtttcgtgctgatcctg
gagaggcccgaacccgtgcaagacctcttcgacttcatcaccgagcgaggagccctccag
gaggagctggcccggagcttcttctggcaggtgctggaggccgtgcggcattgccacaac
tgcggggttctccaccgcgacatcaaggacgagaacatcttaatcgacctgaaccgcggc
gaactcaaactcatcgacttcgggtcgggggcgctgctcaaggacacagtctacacggac
tttgacggaacccgagtgtacagtcctccagagtggattcgctaccatcgctaccacggc
aggtcggctgctgtttggtccctggggatcctgctctatgacatggtctgcggagatatt
ccatttgagcacgacgaagagatcgtcaagggccaagtgtactttaggcaaagggtctct
tcagaatgtcaacatcttattagatggtgcctgtccctgagaccatcggaccggccctcc
tttgaagaaatccagaaccatccgtggatgcaggatgttctcctgccccaggccaccgcc
gagattcatctgcacagcctgtcaccatcacccagcaaatag

DBGET integrated database retrieval system