KEGG   Rattus norvegicus (rat): 24653Help
Entry
24653             CDS       T01003                                 

Gene name
Pla2g4a, Pla2c, Pla2g4, cPLA2
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    24653 (Pla2g4a)
   00565 Ether lipid metabolism
    24653 (Pla2g4a)
   00590 Arachidonic acid metabolism
    24653 (Pla2g4a)
   00591 Linoleic acid metabolism
    24653 (Pla2g4a)
   00592 alpha-Linolenic acid metabolism
    24653 (Pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24653 (Pla2g4a)
   04010 MAPK signaling pathway
    24653 (Pla2g4a)
   04370 VEGF signaling pathway
    24653 (Pla2g4a)
   04072 Phospholipase D signaling pathway
    24653 (Pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24653 (Pla2g4a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24653 (Pla2g4a)
   04664 Fc epsilon RI signaling pathway
    24653 (Pla2g4a)
   04666 Fc gamma R-mediated phagocytosis
    24653 (Pla2g4a)
  09152 Endocrine system
   04912 GnRH signaling pathway
    24653 (Pla2g4a)
   04913 Ovarian steroidogenesis
    24653 (Pla2g4a)
   04921 Oxytocin signaling pathway
    24653 (Pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24653 (Pla2g4a)
  09156 Nervous system
   04724 Glutamatergic synapse
    24653 (Pla2g4a)
   04726 Serotonergic synapse
    24653 (Pla2g4a)
   04730 Long-term depression
    24653 (Pla2g4a)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24653 (Pla2g4a)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    24653 (Pla2g4a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     24653 (Pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 24653
NCBI-ProteinID: NP_598235
RGD: 67366
Ensembl: ENSRNOG00000002657
UniProt: Q6IRF5
Position
13q21
AA seq 752 aa AA seqDB search
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGTFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSCPDLRFSMALCDQEKTFRQQRKENIKENMKKLLGPKKSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIQNRMSTTLSSLKEKVSAARCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMTPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAKHIVSNDSSDSDDEAQGPKGTENEDAEREYQNDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRDFSPQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDTSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVLRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKDAIVESIEYRR
QNPSRCSVSLSNVEARKFFNKEFLSKPTAESI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcatagatccttatcagcacataatagtggaacaccagtattcccataagttt
acagtagtggttctacgtgccaccaaagtaaccaaggggacctttggcgatatgctggac
actcctgatccttatgtggaacttttcatctctacaacccctgacagcaggaagcgaaca
agacacttcaataatgatataaaccctgtgtggaatgagacctttgagttcattttggat
cctaatcaggaaaatgttttggagatcacattgatggatgccaattacgtcatggatgaa
accctaggcacagctacatttcctgtatcttctatgaaggtgggagagaagaaagaagtc
ccttttattttcaaccaagtcacagaaatgattctggaaatgtctcttgaagtttgctca
tgcccagacctacggttcagcatggcactgtgtgatcaggagaaaacattcaggcagcag
aggaaagagaacataaaagagaacatgaagaaacttttgggtccaaaaaagagcgagggg
ctttattccacacgtgatgtgcctgtggtggccattttgggttccggcgggggtttccgg
gccatggtgggattctccggtgtgatgaaggcgctctatgaatcagggattttggattgt
gcgacctacgttgctggtctgtccggctccacatggtacatgtcaaccttgtactcccac
cctgattttccagagaaaggtcctgaggagattaatgaagagctaatgaaaaatgttagc
cacaaccctctcttacttcttacgccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagttctggccaacctgtcacctttactgacatctttggaatgttaatagga
gaaacactaattcaaaatagaatgagtacgaccttgagtagcttgaaggaaaaggtcagc
gccgcccggtgtcctctgcctctcttcacctgtctccatgtcaaaccggacgtgtcagag
ctgatgtttgccgattgggtagaatttagtccatacgaaattggcatggcaaaatatggt
acctttatgactcctgacctgtttggaagcaaattttttatgggaacagttgtaaaaaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttctatactg
ttcaacagagttttgggagtttctggctcacagaataaaggttctacaatggaggaggaa
ttagaaaatattacagcaaagcacattgtgagtaacgacagctctgacagcgatgacgag
gcccaaggacccaaaggcaccgagaatgaagatgcggaaagagagtaccaaaatgacaac
caagcaagttgggtccatcggatgctaatggccttggtgagtgactcagctttattcaat
acccgagaaggacgtgctgggaaggtgcataacttcatgttgggcttgaatctcaacaca
tcgtatccactgtctcccctgagagacttcagcccccaagattccttcgatgatgatgaa
ctcgacgcagcggtagcagatccagatgaatttgaacgaatatatgaaccactggatgtc
aaaagtaaaaagattcatgttgtagacagtgggctcacgtttaacctgccgtatcccttg
attctgcgacctcagagaggtgtggatctcatcatttcctttgacttttctgcaaggcca
agtgacaccagccctccattcaaggaacttctgcttgcagagaagtgggctaaaatgaac
aagctcccttttccaaagattgatccttacgtgtttgatcgggaaggattgaaggaatgc
tatgtgtttaaacctaagaatcctgatgtggagaaggattgcccaaccattatccacttt
gttctggccaacatcaacttcagaaagtacaaggccccaggtgttctgagggaaaccaag
gaagagaaagaaatagctgactttgacattttcgatgaccccgaatcgccattttcaacc
ttcaacttccagtatccaaatcaagcattcaaaaggctacatgatctgatgtacttcaac
acactgaacaacattgatgtgataaaggatgccattgttgagagcattgaatacagaaga
cagaacccatctcgttgctctgtttccctcagtaatgttgaggcaagaaaattcttcaac
aaggagttcctaagtaaacccacagcagagtccatttga

DBGET integrated database retrieval system