KEGG   Rattus norvegicus (rat): 24653
Entry
24653             CDS       T01003                                 

Gene name
Pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    24653 (Pla2g4a)
   00565 Ether lipid metabolism
    24653 (Pla2g4a)
   00590 Arachidonic acid metabolism
    24653 (Pla2g4a)
   00591 Linoleic acid metabolism
    24653 (Pla2g4a)
   00592 alpha-Linolenic acid metabolism
    24653 (Pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24653 (Pla2g4a)
   04014 Ras signaling pathway
    24653 (Pla2g4a)
   04370 VEGF signaling pathway
    24653 (Pla2g4a)
   04072 Phospholipase D signaling pathway
    24653 (Pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24653 (Pla2g4a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24653 (Pla2g4a)
   04664 Fc epsilon RI signaling pathway
    24653 (Pla2g4a)
   04666 Fc gamma R-mediated phagocytosis
    24653 (Pla2g4a)
  09152 Endocrine system
   04912 GnRH signaling pathway
    24653 (Pla2g4a)
   04913 Ovarian steroidogenesis
    24653 (Pla2g4a)
   04921 Oxytocin signaling pathway
    24653 (Pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24653 (Pla2g4a)
  09156 Nervous system
   04724 Glutamatergic synapse
    24653 (Pla2g4a)
   04726 Serotonergic synapse
    24653 (Pla2g4a)
   04730 Long-term depression
    24653 (Pla2g4a)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24653 (Pla2g4a)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    24653 (Pla2g4a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     24653 (Pla2g4a)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 24653
NCBI-ProteinID: NP_598235
RGD: 67366
Ensembl: ENSRNOG00000002657
UniProt: Q6IRF5
Position
13
AA seq 752 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGTFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSCPDLRFSMALCDQEKTFRQQRKENIKENMKKLLGPKKSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIQNRMSTTLSSLKEKVSAARCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMTPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAKHIVSNDSSDSDDEAQGPKGTENEDAEREYQNDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRDFSPQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDTSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVLRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKDAIVESIEYRR
QNPSRCSVSLSNVEARKFFNKEFLSKPTAESI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgtctttcatagatccttatcagcacataatagtggaacaccagtattcccataagttt
acagtagtggttctacgtgccaccaaagtaaccaaggggacctttggcgatatgctggac
actcctgatccttatgtggaacttttcatctctacaacccctgacagcaggaagcgaaca
agacacttcaataatgatataaaccctgtgtggaatgagacctttgagttcattttggat
cctaatcaggaaaatgttttggagatcacattgatggatgccaattacgtcatggatgaa
accctaggcacagctacatttcctgtatcttctatgaaggtgggagagaagaaagaagtc
ccttttattttcaaccaagtcacagaaatgattctggaaatgtctcttgaagtttgctca
tgcccagacctacggttcagcatggcactgtgtgatcaggagaaaacattcaggcagcag
aggaaagagaacataaaagagaacatgaagaaacttttgggtccaaaaaagagcgagggg
ctttattccacacgtgatgtgcctgtggtggccattttgggttccggcgggggtttccgg
gccatggtgggattctccggtgtgatgaaggcgctctatgaatcagggattttggattgt
gcgacctacgttgctggtctgtccggctccacatggtacatgtcaaccttgtactcccac
cctgattttccagagaaaggtcctgaggagattaatgaagagctaatgaaaaatgttagc
cacaaccctctcttacttcttacgccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagttctggccaacctgtcacctttactgacatctttggaatgttaatagga
gaaacactaattcaaaatagaatgagtacgaccttgagtagcttgaaggaaaaggtcagc
gccgcccggtgtcctctgcctctcttcacctgtctccatgtcaaaccggacgtgtcagag
ctgatgtttgccgattgggtagaatttagtccatacgaaattggcatggcaaaatatggt
acctttatgactcctgacctgtttggaagcaaattttttatgggaacagttgtaaaaaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttctatactg
ttcaacagagttttgggagtttctggctcacagaataaaggttctacaatggaggaggaa
ttagaaaatattacagcaaagcacattgtgagtaacgacagctctgacagcgatgacgag
gcccaaggacccaaaggcaccgagaatgaagatgcggaaagagagtaccaaaatgacaac
caagcaagttgggtccatcggatgctaatggccttggtgagtgactcagctttattcaat
acccgagaaggacgtgctgggaaggtgcataacttcatgttgggcttgaatctcaacaca
tcgtatccactgtctcccctgagagacttcagcccccaagattccttcgatgatgatgaa
ctcgacgcagcggtagcagatccagatgaatttgaacgaatatatgaaccactggatgtc
aaaagtaaaaagattcatgttgtagacagtgggctcacgtttaacctgccgtatcccttg
attctgcgacctcagagaggtgtggatctcatcatttcctttgacttttctgcaaggcca
agtgacaccagccctccattcaaggaacttctgcttgcagagaagtgggctaaaatgaac
aagctcccttttccaaagattgatccttacgtgtttgatcgggaaggattgaaggaatgc
tatgtgtttaaacctaagaatcctgatgtggagaaggattgcccaaccattatccacttt
gttctggccaacatcaacttcagaaagtacaaggccccaggtgttctgagggaaaccaag
gaagagaaagaaatagctgactttgacattttcgatgaccccgaatcgccattttcaacc
ttcaacttccagtatccaaatcaagcattcaaaaggctacatgatctgatgtacttcaac
acactgaacaacattgatgtgataaaggatgccattgttgagagcattgaatacagaaga
cagaacccatctcgttgctctgtttccctcagtaatgttgaggcaagaaaattcttcaac
aaggagttcctaagtaaacccacagcagagtccatttga

KEGG   Rattus norvegicus (rat): 296091
Entry
296091            CDS       T01003                                 

Gene name
Pla2g4e
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    296091 (Pla2g4e)
   00565 Ether lipid metabolism
    296091 (Pla2g4e)
   00590 Arachidonic acid metabolism
    296091 (Pla2g4e)
   00591 Linoleic acid metabolism
    296091 (Pla2g4e)
   00592 alpha-Linolenic acid metabolism
    296091 (Pla2g4e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    296091 (Pla2g4e)
   04014 Ras signaling pathway
    296091 (Pla2g4e)
   04370 VEGF signaling pathway
    296091 (Pla2g4e)
   04072 Phospholipase D signaling pathway
    296091 (Pla2g4e)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    296091 (Pla2g4e)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    296091 (Pla2g4e)
   04664 Fc epsilon RI signaling pathway
    296091 (Pla2g4e)
   04666 Fc gamma R-mediated phagocytosis
    296091 (Pla2g4e)
  09152 Endocrine system
   04912 GnRH signaling pathway
    296091 (Pla2g4e)
   04913 Ovarian steroidogenesis
    296091 (Pla2g4e)
   04921 Oxytocin signaling pathway
    296091 (Pla2g4e)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    296091 (Pla2g4e)
  09156 Nervous system
   04724 Glutamatergic synapse
    296091 (Pla2g4e)
   04726 Serotonergic synapse
    296091 (Pla2g4e)
   04730 Long-term depression
    296091 (Pla2g4e)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    296091 (Pla2g4e)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    296091 (Pla2g4e)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     296091 (Pla2g4e)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 296091
NCBI-ProteinID: XP_017447688
RGD: 1310595
Ensembl: ENSRNOG00000024904
Position
3
AA seq 900 aa
MGQKSRLLSLRQEPRQETPSVDSGKPELESRHDASEADACLGFPLPVRHMPSRRWQVLGA
ERHGNERAAACLTLEMSTIGEETSQNKQCQKSMWAAARQEGSSPCHLLTVRIISMKNVRQ
ADILSQTDCFVTLWLPTASQKKLRTRTISNCPHPEWNESFTFQIQTRVKNVLEFSICDED
TLTQSDHLLTVLYDLSKLCLRNKTHVKFPLNPEGMEELEVEFLLEENVSSSETLITNGVL
VSRQVSCLEVHAESRRPRKRKKNKNLLVMVTDSFENTQCVQPCLEPCCPNPACFHYPKYS
QPQLYAEAPKSHWSYRLCCCEAQRNDTVCQPLDCLSDGQPMTLPLGENYELHMKSSPCSN
TLDVRLGFSLCQEEVEFLQKRKVAVTKALNQVLQLEEGLHEHEVPMIAIMATGGGTRSMV
SLYGHLLGLQKLNLLDCSVYLTGLSGATWTMATLYSDPEWSSKDLEPVVFEARRHVVKDK
MPALYPDQLCKWQEELRQHSQEGYKTTFTDFWGKLVEYSLGDKKNECKLSEQRAALCRGQ
NPLPIYLTINVKDDVSNQDFREWFEFSPYEVGMQKYGAFIPTELFGSEFFMGRLMKRIPE
PEMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFYRWTREKLHDIEDDPLLPEIPRCDANPL
ETTVVIPATWLSNTFREILTHRPLVSEFHNFLYGLQLHTDYLQNKQFCMWKDTVLDTFPN
QLTQFTKHLNLLDTAFFVNSSYAPLLRPERKVDLIIHLNYCAGSQTKPLKQTCEYCTEQN
IPFPNYSIQEDDKSLKECYVMENPQEPDAPIVVYFPLINDTFQKYKAPGVERSPEELELG
QLNIYGPKSPYATKELTYTEAAFDKLVKLSEYNILNNKDKLIQAVRLAMEKKRMKSQCPS
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgggccagaaaagccggttgttgagcctcaggcaagagcccagacaggaaactcccagt
gtggattcaggcaagccagagctggagagccgccacgatgcttcagaggcagatgcctgc
ttgggtttcccactccctgtcagacacatgccaagcagaagatggcaggtgctcggagcg
gagagacacggaaatgaaagagcagcagcatgtctcactctagagatgtctacaatagga
gaggagactagccaaaacaaacaatgtcagaagagcatgtgggctgctgcacggcaggag
gggtcgtctccatgccatctattgacagtgaggatcattagcatgaaaaatgttcggcag
gctgatatattgagtcagacagattgctttgtgaccctctggctgcctactgcctctcag
aagaagctgaggaccagaaccatctccaactgcccacacccagagtggaatgaaagcttc
acctttcagatccagactcgagtaaagaatgttctagagttcagcatctgtgatgaagat
acgctgacacaaagtgaccatctcttgacagtcctctatgacctctccaagctctgcctt
cggaataaaacccacgtgaagttcccactcaacccagagggcatggaagaactggaagtg
gagttcctgctcgaagaaaatgtctcctcatcagagaccctcatcaccaatggcgtgctg
gtgtctcgccaagtctcttgcctggaagttcatgcagaatccaggaggccaaggaagagg
aagaaaaacaaaaaccttctggtgatggtgacagactccttcgagaacacccagtgtgtc
cagccctgtctggagccctgctgccccaatcctgcctgcttccactaccccaaatactcc
cagccccagctttatgcagaggcacctaagagccactggagctataggctttgctgctgt
gaagcacaaaggaatgacacagtctgccagcccctcgattgcctttctgatggccagccg
atgaccctgcctttgggagagaactatgagttacacatgaagtcctcaccctgctctaac
acactggatgtgcggctcgggttcagcctgtgccaggaagaggtggagtttctgcagaag
cggaaggtggcggtgaccaaggcactgaatcaagtgctgcaactggaggagggcctgcat
gagcatgaggtaccgatgatagccatcatggccacaggaggtggcacgaggtctatggtc
tccttgtatggccacttgctggggctgcagaagctgaaccttctggactgttctgtttac
ctcaccggcttgtcaggtgcaacctggacaatggctaccttgtacagtgatcctgagtgg
tcatccaaagacctggagcctgtagtctttgaggcccggagacatgttgtcaaagacaag
atgcctgcattgtacccagatcagctctgcaaatggcaagaggaactccgacaacacagc
caggagggctacaagaccacgttcacagacttttggggcaagctggtggagtacagtctg
ggagataagaaaaatgaatgcaagctgtcagaacagcgagctgctctgtgccggggacag
aaccctctgcccatctacctcactatcaatgtcaaggatgatgtaagcaaccaggatttc
agagaatggttcgagttctccccctacgaagtgggcatgcagaagtacggagccttcatc
cccacggagctatttggctctgagttcttcatggggcggctgatgaagaggattcctgag
ccagagatgtgctacatgctagggttgtggagtagcatcttttccctgaacctgcttgat
gcttggaatctgtcccacacctcggaggagtttttctataggtggaccagggagaaactg
catgacatcgaagatgatcccctcctgcctgaaatccccagatgtgatgctaaccccttg
gagaccacagtagtgatcccagccacatggctgtccaacaccttccgagaaatcctcaca
cacaggcccttggtgtctgagttccacaacttcctgtacgggttgcagctgcacaccgac
tacttacagaacaaacagttctgtatgtggaaagacacagtactggacactttcccaaac
cagctgacacagtttacaaaacacctgaacctgctggacactgcattctttgtcaactcc
agctatgcgcccctccttaggccagagagaaaagtcgaccttatcatccatctcaattac
tgcgcaggatcccagacaaagcccctgaaacaaacctgcgagtactgcacggagcagaat
atccccttccccaactactccatccaggaggacgacaaaagtctcaaggagtgctatgtg
atggagaatccccaggagcctgatgcgcccatcgtggtctacttcccactcatcaatgac
accttccagaagtacaaggctccaggtgtagagcgaagtcctgaggagctagaactgggc
cagctgaacatctatggaccaaagtctccctatgccaccaaggagctgacgtacacagag
gccgccttcgacaagctggtgaagctctcagagtataacatcctcaataacaaagacaag
ctcattcaggccgtgagactagcaatggagaagaaacgcatgaagagccagtgtccctcc
tag

KEGG   Rattus norvegicus (rat): 311341
Entry
311341            CDS       T01003                                 

Gene name
Pla2g4b
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    311341 (Pla2g4b)
   00565 Ether lipid metabolism
    311341 (Pla2g4b)
   00590 Arachidonic acid metabolism
    311341 (Pla2g4b)
   00591 Linoleic acid metabolism
    311341 (Pla2g4b)
   00592 alpha-Linolenic acid metabolism
    311341 (Pla2g4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    311341 (Pla2g4b)
   04014 Ras signaling pathway
    311341 (Pla2g4b)
   04370 VEGF signaling pathway
    311341 (Pla2g4b)
   04072 Phospholipase D signaling pathway
    311341 (Pla2g4b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    311341 (Pla2g4b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    311341 (Pla2g4b)
   04664 Fc epsilon RI signaling pathway
    311341 (Pla2g4b)
   04666 Fc gamma R-mediated phagocytosis
    311341 (Pla2g4b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    311341 (Pla2g4b)
   04913 Ovarian steroidogenesis
    311341 (Pla2g4b)
   04921 Oxytocin signaling pathway
    311341 (Pla2g4b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    311341 (Pla2g4b)
  09156 Nervous system
   04724 Glutamatergic synapse
    311341 (Pla2g4b)
   04726 Serotonergic synapse
    311341 (Pla2g4b)
   04730 Long-term depression
    311341 (Pla2g4b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    311341 (Pla2g4b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    311341 (Pla2g4b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     311341 (Pla2g4b)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2 MCCA_BT
Other DBs
NCBI-GeneID: 311341
NCBI-ProteinID: NP_001101234
RGD: 1308658
Ensembl: ENSRNOG00000007447
UniProt: D4A1I6
Position
3
AA seq 791 aa
MALQTCPVYMQAKVPETHLLTVRVLQASGLPSKDLVTSSDCYVTLNLPTASSGTLQTRTV
KNSRNPVWNQNFHFRIHRQLKNVMELKVFDQDLMTKDDPVLSVLFDVGTLQVGTQRQSFS
LSAQEDGRLEVEFRLQTLTDCEEQLISNGILVAQELSCLHVELKRTGDPKRSERKVQLVV
AAACEGPQEAPVGTGSFRFHYPACWEQELSVHLQDDPHEQLKVPLRTLPSSQLVRLVFPT
SQEPLMRLELKKEDGPKELAVRLGCGPCPEEQAFLSKRKQVVAAALKKALQLDQDLQEDE
IPVIAVMATGGGIRAMTSLYGQLAGLKELGLLDCISYITGASGSTWALANLYEDPEWSQK
DLAGPTEMLKTQVTKSKLGALAPSQLWRYRQELAERARLGYPTCFTNLWALINEALLHDK
PHEHKLSDQREALSRGQNPLPIYCALNSKEKGLSTFEFGEWCEFSPYEVGFPKYGAFIPS
ELFGSEFFMGRLVKQLPESRICFLEGIWSNLFAASLQDSFYWSSEPSQFWDRWAQDQANL
DKEQVSHLKIAEPPTAAGKIAELFTDLLTKRPLAQATHNFMRGLHFHKDYFHHPHFSTWK
ASKLDKFPNQLTPAEPHLCLLDVGYFINTSCPPLLQPTRDVDLILSLDYNLSGAFQQLQL
VSRFCQEQGIPFPSISPSPEEQRQPQECHMFCDPAQPEAPAVLHFPLVNDSFRDHSAPGV
PRTSEEKTAGEVNLSSSNSPYDYTKVTYSQEDVDKLLRLTHYNICNNQDRLREAMHQAVQ
RRRNRRQFRRE
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggctctgcaaacctgcccggtctacatgcaggcaaaggtgccagagacacacctgctc
actgtccgcgtcctccaggctagtggcctgccttccaaggacctagtgacatcctctgac
tgctatgtgactctgaacctgcccacggcctccagcggcacgctccagacacgcacagtc
aagaacagcagaaacccagtctggaatcagaacttccacttccggatccataggcagctc
aagaatgttatggaactgaaagtctttgaccaggacctgatgaccaaagatgacccagtg
ttgtcagtgctgtttgacgtggggactctgcaagttgggactcagcgccagagcttctca
ttgagcgctcaggaggatgggcgcttggaagttgagtttcggctacagactctgacagac
tgtgaggaacagcttatcagcaatggtatcctggtggcccaggagctctcctgcttgcat
gttgaactgaagaggacaggagacccaaagaggtcagagcgcaaagttcaacttgtggtt
gctgcggcctgcgagggtccacaggaagcccctgtgggcaccgggtctttccgcttccat
tatccagcctgctgggagcaagagctcagtgttcatctgcaggatgacccccatgagcag
ctgaaggtgccattgcgaactctaccctcttcgcagctggtgagacttgtcttccccacg
tcccaggagccactgatgaggttggaactcaagaaagaagacgggccaaaggagctggcc
gtgcggctgggctgtgggccctgccccgaggaacaggccttcctaagcaagaggaagcag
gtggtggccgccgccctgaaaaaggccttacagctggaccaagacctgcaggaggacgag
atcccagtgattgctgtgatggccactggtggtgggatccgggcgatgacttcgttatac
ggacagctggctggcctgaaggagcttggccttctggactgcatctcctacatcactggg
gcttcagggtccacatgggcattggccaatctctatgaggacccagagtggtctcagaag
gacctagcagggcccactgagatgctgaagacccaggtaacaaagagcaaactgggcgca
ttggcccccagccagctttggcggtaccggcaagagctggctgagcgtgctcgcctgggc
tacccaacctgcttcaccaacctgtgggcccttattaatgaggccttgctgcacgacaag
ccacatgaacacaaactctcagatcaacgagaggccctgagtcgaggccagaaccctctg
cctatctactgtgcccttaatagcaaggagaagggcctaagcacctttgaatttggcgaa
tggtgcgagttctctccctacgaagtcggcttccccaagtacggagccttcatcccctct
gagctctttggttctgagtttttcatggggcggctggtgaagcagctccctgagtctcgc
atttgcttcctggaaggtatctggagcaatctgtttgcagccagcctccaagacagcttc
tactggtcctctgaacccagccagttctgggaccgctgggcccaggatcaggccaatctg
gacaaagagcaggtctcccatctgaagatagcagaacctcccacagcggctggcaagatc
gcagagctcttcactgacctcctgacaaagcgccccctcgcccaggccacccacaacttc
atgcgcggtctccatttccacaaggactatttccaccaccctcacttctccacctggaaa
gcttccaaactagacaagttccccaaccagctgacacccgccgagccccacctctgcctc
ctggatgttggctatttcatcaacactagttgcccacccctccttcagccaacacgggat
gtggacctcatcttgtcactggactacaacctctccggagcctttcagcagctgcagctt
gtgagccggttctgccaggagcagggcattcctttcccatccatctcgcccagccctgag
gagcagcgtcagcctcaggagtgccatatgttctgtgacccagcccagcccgaagcccca
gctgtgttgcacttccccctggtcaatgactccttcagggaccactcagcccctggggtg
ccacggacgtcggaggagaagacagctggggaggtgaatctgtcttcctccaactcccca
tatgactacacaaaagtgacctacagccaggaagatgtggacaagctgttacgactgacg
cattacaacatctgcaacaaccaggatcggctgcgggaggccatgcaccaggccgtgcag
cggcggagaaaccgcagacagtttaggcgggagtga

KEGG   Rattus norvegicus (rat): 691810
Entry
691810            CDS       T01003                                 

Gene name
Pla2g4c
Definition
(RefSeq) phospholipase A2, group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    691810 (Pla2g4c)
   00565 Ether lipid metabolism
    691810 (Pla2g4c)
   00590 Arachidonic acid metabolism
    691810 (Pla2g4c)
   00591 Linoleic acid metabolism
    691810 (Pla2g4c)
   00592 alpha-Linolenic acid metabolism
    691810 (Pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    691810 (Pla2g4c)
   04014 Ras signaling pathway
    691810 (Pla2g4c)
   04370 VEGF signaling pathway
    691810 (Pla2g4c)
   04072 Phospholipase D signaling pathway
    691810 (Pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    691810 (Pla2g4c)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    691810 (Pla2g4c)
   04664 Fc epsilon RI signaling pathway
    691810 (Pla2g4c)
   04666 Fc gamma R-mediated phagocytosis
    691810 (Pla2g4c)
  09152 Endocrine system
   04912 GnRH signaling pathway
    691810 (Pla2g4c)
   04913 Ovarian steroidogenesis
    691810 (Pla2g4c)
   04921 Oxytocin signaling pathway
    691810 (Pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    691810 (Pla2g4c)
  09156 Nervous system
   04724 Glutamatergic synapse
    691810 (Pla2g4c)
   04726 Serotonergic synapse
    691810 (Pla2g4c)
   04730 Long-term depression
    691810 (Pla2g4c)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    691810 (Pla2g4c)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    691810 (Pla2g4c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     691810 (Pla2g4c)
SSDB
Motif
Pfam: PLA2_B
Other DBs
NCBI-GeneID: 691810
NCBI-ProteinID: NP_001139454
RGD: 1594658
Ensembl: ENSRNOG00000026764
Position
1
AA seq 587 aa
MGSGVYFATGLQEEERRAVHKRSFKVLEGLKKLNIQADQAPVIAVLGSGGGLRAHIACLG
VLSAMKELGLLDAVTYLAGVSGSTWALSSFYTKNGNMQGIEEELKHRYEKNEWHFDESLD
KAIQASRRENYSLTDFWAYLVVSRQTRELHDSNLSSFKKQVEEGVLPYPIFAAIDDDLQD
DWREKKVQNSWFEFTPHHAGYPALRAYVPITEFGSRFENGKLVRPEPERDLTFLRGLWGS
ALADIKEDKAFIRDYFKDMYEKLKFLTGAKTMTYSNAEQMDVDEMFLDLLMAYAIDQDDP
SIKDKLCVMQQALGPETGEFGKEMAEIIQNWNEISSEKKEQFLDYLLDYLKKPQEPITYS
LISIGNWIGDLFYDALTFVRKTGMCLWEWQWGTVYNFLYKHDNIADETMCSREFLHLVDA
GLAINTPYPLILTPVREAHLILSFDFSDGDPFETIRATADYCYQHEIPFPEVSEDQLKEW
AKSPKSCYILRGETGPVVMHFTLFNKDNCGDDIVTWRKQYKTMKLSDSYTPSMVTDLLRV
SKENVQKNKDKIVNEMREVTGYKKGNFLEVNGSKELENKKDIGRRKW
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgggctctggggtttactttgccactggactccaggaagaagaaaggcgtgctgtgcac
aaacgcagtttcaaggtgttggagggtctaaaaaagctgaacatccaagcagaccaggct
ccagtcattgctgtcctgggctctggtggggggcttcgagcccatatcgcttgtcttggg
gtgctgagtgctatgaaagaacttggcctgttggatgctgtcacatacctcgcaggggtt
tctggatccacttgggcactgtcttcattctataccaagaatggaaatatgcaagggata
gaagaggagctgaaacatcggtatgagaagaatgagtggcactttgatgagagcctggac
aaagccatccaggcatcaaggagggagaattattccctgactgacttttgggcctatttg
gttgtttcaaggcaaaccagagagcttcatgattcaaatttgtccagcttcaagaagcaa
gtggaagaaggagtgttgccctatcccatctttgcagccattgatgatgaccttcaggat
gattggagggagaaaaaagttcaaaattcctggtttgaattcactcctcatcatgctgga
tatcctgcacttagggcttatgtcccaatcacagagtttggaagcagatttgaaaatgga
aaactggttagacctgagcctgagagagacctgactttcctgagaggtttatggggaagt
gcccttgctgatattaaagaagataaggcatttattagggactatttcaaggacatgtat
gaaaaactgaagttcttaacaggggctaaaacaatgacatactcaaatgcagaacaaatg
gatgtggatgaaatgttcttggatttactgatggcttatgccatagatcaggatgaccct
agcatcaaggataagctctgtgtcatgcagcaggccctgggtcctgagacaggtgagttt
ggcaaagagatggctgagatcatccagaattggaatgagatttcctcagagaagaaggag
cagtttctggactatctgttggattacttgaagaagccacaagagcccatcacatacagc
ttgatcagtatcgggaactggattggggatttattctatgatgctctaacttttgtgaga
aaaactggaatgtgcctttgggagtggcagtggggaacagtttacaacttcctttataaa
cacgataacattgcagatgagaccatgtgcagccgggagtttctccatctggtggacgct
ggtcttgccatcaacactccctacccacttattctgactcctgtgcgtgaagctcacctc
atcctctcatttgacttcagtgatggggatccatttgagaccatcagggccacagcagac
tactgttaccagcatgaaatcccttttcctgaagtgagtgaagatcagctgaaggagtgg
gccaaatccccgaagagctgctacatcctcagaggggaaacaggacctgttgtcatgcac
tttactcttttcaacaaagacaactgtggagatgacattgtgacttggagaaaacaatat
aagacaatgaaactctctgattcatacacaccgagcatggtgacagatttgctgagggta
tctaaggagaatgtgcagaaaaacaaagacaaaattgtgaatgagatgagggaagtcact
ggctacaaaaagggcaatttcctggaggtaaatgggtccaaagagttggagaacaagaag
gacattgggagacgaaaatggtga

KEGG   Rattus norvegicus (rat): 691905
Entry
691905            CDS       T01003                                 

Gene name
Pla2g4d
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    691905 (Pla2g4d)
   00565 Ether lipid metabolism
    691905 (Pla2g4d)
   00590 Arachidonic acid metabolism
    691905 (Pla2g4d)
   00591 Linoleic acid metabolism
    691905 (Pla2g4d)
   00592 alpha-Linolenic acid metabolism
    691905 (Pla2g4d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    691905 (Pla2g4d)
   04014 Ras signaling pathway
    691905 (Pla2g4d)
   04370 VEGF signaling pathway
    691905 (Pla2g4d)
   04072 Phospholipase D signaling pathway
    691905 (Pla2g4d)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    691905 (Pla2g4d)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    691905 (Pla2g4d)
   04664 Fc epsilon RI signaling pathway
    691905 (Pla2g4d)
   04666 Fc gamma R-mediated phagocytosis
    691905 (Pla2g4d)
  09152 Endocrine system
   04912 GnRH signaling pathway
    691905 (Pla2g4d)
   04913 Ovarian steroidogenesis
    691905 (Pla2g4d)
   04921 Oxytocin signaling pathway
    691905 (Pla2g4d)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    691905 (Pla2g4d)
  09156 Nervous system
   04724 Glutamatergic synapse
    691905 (Pla2g4d)
   04726 Serotonergic synapse
    691905 (Pla2g4d)
   04730 Long-term depression
    691905 (Pla2g4d)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    691905 (Pla2g4d)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    691905 (Pla2g4d)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     691905 (Pla2g4d)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 691905
NCBI-ProteinID: XP_001080051
RGD: 1593372
Ensembl: ENSRNOG00000037231
UniProt: D3ZQH6
Position
3
AA seq 825 aa
MWSGDRRVVMESLSPERLPVYPRQEEASVFCQLTVKILEARSLPRADLLSKADPYVTLRL
PTASGRKFKTQTVTNSSNPVWNETFSFLIQSQVKNILELTVYDEDLITKDDICFKISYDI
SEILPGQLVQKTFSLNPQGPEELDVEFLVERTCDPPENLITNNVLVARELSHLDVSLDRA
GSTTMAAGQDKLELELMLKGSYEDTQTFLPDTAFTLSFHYMRSQDTELNGYLRSSRNSDW
NSDTSATPFNVPLTLLAAGKEVTVDIPATKDPERKLQLKTDSCPKELSVRLSYGLCPEEQ
AFLGRRKKLVAAALKQALQLDEDLKEDEVPVVGINAEGGGMRAMISLYGHLLALQKLGLL
DCVTYFSGISGATWTMAHLYRDPEWSQKDLEGPISHAREHVAKSLLKEFLPEHLASYRQT
LKLREEQGYTVTIADLWGLVLESKLHGQVTDQKLSEQRAALERGQNPLPLYLSLNVKENH
LETLHFKEWVEFSPYEVGFLKYGGFVPSELFGSEFFMGRLMKRLPESQICFLEGIWSNLF
SVNLMDIWYDITSGRDSNDFPVDVQNSEKEPSSSAGVSSGVEAPWLQPGTALAQAFKGFL
TGRPFNQRSANFLHGLQLHRDYCNQRDFSTWADCNLDDTPNQLTPQDPQLCLIDAGCFMN
SSCPSLFRSGRQVDLILSFNYNQSFPFKGLQQSGKYCSAQGLPFPRVEPSPEDHLQPQEC
YLFSDPTCPEAPAVLHFPLVNDSFQDHSAPGVRRSPDELKAGQVDLTGVASPYFLYNMTY
KNEDFDRLLRLSEYNIQNNQGTILQALKTVLKRRASETRPLGVKT
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgtggagtggagatagaagagttgtcatggagagcctgtcacctgagagactacctgtc
tatcctcgccaggaggaggcctctgtcttctgccagctcactgtgaaaatcctggaggct
cggagtctgcccagggctgacctgttgagcaaggccgatccatatgtgactctgcgactg
ccaacagcttctggaaggaaattcaagacgcaaacagtcaccaactccagtaatcctgtg
tggaacgagaccttcagtttcctcatccagagtcaggtcaagaatattctagaactgact
gtctatgacgaagacttaattacgaaagatgacatctgtttcaagatttcttatgatatc
tcagaaatcctccctggacaactggtccagaaaaccttcagcctgaatcctcagggacca
gaagagttagacgtggagttcctggtggaaagaacgtgcgaccctccagaaaacctcatc
accaacaatgttcttgtggcccgagaactgtcacacctggatgtctccctggacagagct
ggaagcaccaccatggcagcaggtcaggacaaactagagctggagcttatgctgaagggg
tcgtatgaggacacacagacatttttaccggacacagcttttaccctcagcttccactac
atgaggagccaagacacagagctgaacgggtacctgaggagctccagaaacagtgactgg
aactcagatacctcagcaacacctttcaatgtacccctgacgttgttggctgcagggaag
gaggtgaccgtagacattcctgctacaaaggatccagaaaggaagctgcaacttaagaca
gacagttgccctaaggagctgtctgtgcggctgagctatgggctctgtcccgaggagcag
gccttcctaggcaggaggaaaaagctggttgctgctgccctgaagcaggctctgcaactg
gatgaagacttgaaagaagatgaggtccctgttgtgggcatcaacgccgagggaggaggt
atgcgggctatgatctcactctacggccatctattggcacttcagaagttggggctcctg
gactgtgtgacctacttcagtggcatctctggcgctacatggacaatggcccacctgtac
cgggacccagagtggtcacagaaggaccttgagggacccatcagtcatgccagggagcat
gtggctaaaagcctgctgaaggaattcctccccgaacacttggcaagctaccgtcagact
ctgaagcttcgggaagagcagggctacaccgtcaccatagcagacctgtggggcctggtg
ctggagtccaagctgcatgggcaggtgacagatcagaagctgtcagaacagagagctgca
ctggagcggggtcagaaccctttgcctctctacttgagcctaaatgtcaaagagaaccat
ctggagaccctccactttaaggagtgggtggagttctctccctatgaagttgggttcctg
aaatatggaggcttcgtcccttctgagctctttggctcggagttcttcatgggacggctg
atgaagaggcttcccgagtcccagatttgctttctggaaggtatctggagcaatcttttc
tctgtgaacttgatggatatctggtatgacatcacctctgggagagactcgaacgatttc
cctgtggatgtccagaactcagagaaggagccctcatcctcagcaggagtctcctctggt
gtggaggccccatggctgcagcctggaacagctctggctcaggcattcaagggctttctg
actggcaggccattcaaccagcgtagtgccaacttcctccatggtctccagctgcaccgg
gactactgtaaccagagagacttctccacctgggcagattgcaacctagatgacaccccg
aatcagctgaccccacaggaccctcagctctgcctaattgatgctggctgcttcatgaac
agcagctgtccctccctgttccgctcaggtcgccaagtggacctcatactctccttcaac
tacaatcagtcctttccctttaagggactgcagcaatctgggaaatactgcagcgctcag
ggcctgcccttcccccgtgtggagcccagccctgaagaccacctccagccccaggaatgt
taccttttctcagaccccacctgcccggaagccccagctgtgctgcacttccccctggtc
aatgactccttccaggaccactcagcccctggtgtccggcgcagccctgatgagctcaag
gctgggcaggtggatctcacaggggtcgcctccccctacttcctgtacaacatgacctac
aagaacgaagattttgacaggttgcttcggctctctgagtacaacattcagaacaaccag
ggcactatcctgcaggccctgaagacagttctgaaacggagggcttcagagaccaggcca
ttgggagtgaagacatga

KEGG   Rattus norvegicus (rat): 691907
Entry
691907            CDS       T01003                                 

Gene name
Pla2g4f
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04217  Necroptosis
rno04270  Vascular smooth muscle contraction
rno04370  VEGF signaling pathway
rno04611  Platelet activation
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04724  Glutamatergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04921  Oxytocin signaling pathway
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    691907 (Pla2g4f)
   00565 Ether lipid metabolism
    691907 (Pla2g4f)
   00590 Arachidonic acid metabolism
    691907 (Pla2g4f)
   00591 Linoleic acid metabolism
    691907 (Pla2g4f)
   00592 alpha-Linolenic acid metabolism
    691907 (Pla2g4f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    691907 (Pla2g4f)
   04014 Ras signaling pathway
    691907 (Pla2g4f)
   04370 VEGF signaling pathway
    691907 (Pla2g4f)
   04072 Phospholipase D signaling pathway
    691907 (Pla2g4f)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    691907 (Pla2g4f)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    691907 (Pla2g4f)
   04664 Fc epsilon RI signaling pathway
    691907 (Pla2g4f)
   04666 Fc gamma R-mediated phagocytosis
    691907 (Pla2g4f)
  09152 Endocrine system
   04912 GnRH signaling pathway
    691907 (Pla2g4f)
   04913 Ovarian steroidogenesis
    691907 (Pla2g4f)
   04921 Oxytocin signaling pathway
    691907 (Pla2g4f)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    691907 (Pla2g4f)
  09156 Nervous system
   04724 Glutamatergic synapse
    691907 (Pla2g4f)
   04726 Serotonergic synapse
    691907 (Pla2g4f)
   04730 Long-term depression
    691907 (Pla2g4f)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    691907 (Pla2g4f)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    691907 (Pla2g4f)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     691907 (Pla2g4f)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 691907
NCBI-ProteinID: XP_008760344
RGD: 1593370
Ensembl: ENSRNOG00000008135
Position
3
AA seq 860 aa
MPWTLQPKWLASKGLPLLGAILLRETEKRETQWKHWRQETHPYYDLQVKVLRARNIQHTD
KLSKADCYVQLWLPTASFSPTQTRTVVNCSDPEWNETFHYRIHSAVKNVLELALYDKDVL
DSDKIFSVLFDLSTLQLGQPYTKTFTQKQPGLTDPKELQVEFTLEKSQMPACEVITNGVL
VAHPCLRIQGTVTGDKTASLGEFGSREIQLAVPGAYEKPQSVPLQPTTVEPGLPATFIFH
MNPVLSPRLNIALQEKLLVSHSGPSDELESQTSKMEEASILLSSLPLNQESTRLMNLEEG
QQVTLRMKADMRSEDLDLRLGFELCSGELEFLDKRKQVVSKALQQVMRLSEAPHCDQVPV
IAVLGSGGGTRAMTSLYGSLAGLQELGLLDAVTYLSGVSGSSWCISTLYKDPSWSQKTLQ
GPIRHASARVCSSKVGMLSPERFEYYTREKKTWESRGHSMSFTDLWGLIIEYFLNQEENP
AKLSDQQEMVSQGQNPYPIYASINVHNNISGEDFAEWCEFTPYEVGFPKYGAYVPTELFG
SEFFMGRLLQHWPEPRICYLQGMWGSAFAASLYEIFLKMRGPRLGFLDWHRGTVSVTDDW
PKLRKQDPTRLPTRLFTSKSFFSKAVLDIFTSRFTCAQTFNFTRGLCLYKDYTARKDFVV
SEDAWHSDNYKHLDACPNQLTPMKDFLSLVDGGFAINSPFPLILQPQRAVDLIVSFDYSL
EAPFEVLQVTEKYCRDRGIPFPRIEIDPKDSKDPRECYLFTEAEDPCSPIVLHFPLVNRT
FRKHLAPGVERQTAEEKAFGDFIINGPDTAYGMMDFTYEPIEFDRLVTLSRYNVLNNIET
IRRALQLALDRRQAGGRAGA
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgccctggactctccagccgaagtggctggcaagcaaggggctgccccttcttggagct
atactgctacgggagacagaaaagagggaaacgcagtggaagcattggcggcaggaaacc
cacccatactacgaccttcaagtgaaggtgctgagggctagaaacatccagcacacggat
aaattgtccaaagctgactgctatgttcaactatggctgcccacggcttcttttagcccc
actcagacaaggacagtggttaactgcagtgacccagagtggaatgagacctttcactac
cggatccacagtgctgtgaagaatgtcctggagctagctctttatgacaaggatgtcctg
gacagtgacaagatcttctcagttctgtttgacctgagtactctccagctaggccagcct
tacacaaaaaccttcactcagaagcagcctggactaacagatccaaaagagctgcaagta
gaatttactctggaaaagagtcagatgcctgcatgtgaagtcatcaccaatggtgtcctg
gtggctcatccctgtctgagaattcagggcacagtcactggagacaagacggcctcactt
ggagagtttggctcgagggagatccagctggcagtgcctggggcctatgaaaagccacag
tcagtgcctctgcagccgaccaccgtggagccaggtctcccagcgacctttatctttcac
atgaacccggtgctgagccccaggctgaacatagcactgcaggaaaagctcctggtctca
catagtggcccaagtgatgagctggagtcccagactagcaagatggaggaagcaagcatc
ttgctctcctctctgcccctcaaccaggagtcaacaagacttatgaacctggaggagggc
cagcaggtgacgctgaggatgaaggcagacatgaggtctgaggacttagacctgcgcctt
ggttttgagctgtgtagtggggagctggaatttctggacaagaggaagcaggtggtgtcc
aaggccctgcagcaggtgatgcgactgagtgaggctccacactgtgaccaggtacctgtg
atagccgtgctaggctctgggggtggaaccagagccatgacttccctgtacggcagcctg
gccgggctgcaggagcttggtcttctggatgctgtgacctacctgagtggggtttctgga
tcttcctggtgcatctctacactctacaaggatccatcctggtcgcagaagactttgcag
ggccccattcgacatgcctcggctcgagtctgcagcagtaaagtagggatgctgtcccca
gagcggttcgaatactacacccgggaaaagaagacctgggagagcagaggccacagcatg
tccttcactgacttgtggggcctcatcattgagtatttcctcaaccaggaggaaaaccct
gctaagctgtcagaccaacaagaaatggtcagccagggtcagaacccttaccccatctat
gccagcatcaatgtccacaacaacatcagtggggaagactttgcagagtggtgcgagttc
accccttatgaggtcggtttccccaagtacggggcttatgtccccacggaactctttggc
tctgagttcttcatgggtcggctactgcagcactggccagagccccgcatctgttacctg
cagggtatgtggggaagtgcttttgcagccagcctgtatgagatcttcctgaagatgaga
ggcccaagactgggcttcctggactggcacagaggcactgtcagtgtcacagatgactgg
ccaaagttacggaagcaggaccccactcggctgcccaccaggctctttacctcaaagagt
ttcttctctaaggctgtgctggacatattcacctcccgctttacttgtgcccagaccttt
aactttacccgaggtctctgcctgtacaaggactacacagctagaaaggactttgtggtc
tctgaagatgcatggcattcagataattacaaacacctcgatgcctgtcccaaccagctc
acacccatgaaggacttcctgtccttagtggatggaggctttgccatcaactcaccattc
ccactgatcctgcagccgcagcgggctgtggacctcattgtgtcctttgactattccctg
gaagccccttttgaggtcctgcaggtgacagagaagtactgccgggaccgagggatcccc
ttcccaaggattgagatagaccccaaggactctaaggacccccgtgaatgctatctgttt
actgaggcggaggacccctgctcgcccattgtgctgcattttccccttgtcaacaggacc
tttcgcaaacacctggctccaggagtggaacgacaaacagctgaggagaaggccttcggg
gactttatcatcaacgggccagatactgcctatggaatgatggacttcacctatgagccc
atagagtttgatcgactggtgaccctgagtcgatacaatgtcttgaacaacattgagact
atcaggcgtgccctccagctggctctggaccggcggcaggctgggggaagggctggtgcc
tga

DBGET integrated database retrieval system