KEGG   Rattus norvegicus (rat): 24654
Entry
24654             CDS       T01003                                 

Gene name
Plcb1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    24654 (Plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24654 (Plcb1)
   04310 Wnt signaling pathway
    24654 (Plcb1)
   04371 Apelin signaling pathway
    24654 (Plcb1)
   04020 Calcium signaling pathway
    24654 (Plcb1)
   04070 Phosphatidylinositol signaling system
    24654 (Plcb1)
   04072 Phospholipase D signaling pathway
    24654 (Plcb1)
   04071 Sphingolipid signaling pathway
    24654 (Plcb1)
   04022 cGMP-PKG signaling pathway
    24654 (Plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24654 (Plcb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24654 (Plcb1)
   04613 Neutrophil extracellular trap formation
    24654 (Plcb1)
   04621 NOD-like receptor signaling pathway
    24654 (Plcb1)
   04062 Chemokine signaling pathway
    24654 (Plcb1)
  09152 Endocrine system
   04911 Insulin secretion
    24654 (Plcb1)
   04922 Glucagon signaling pathway
    24654 (Plcb1)
   04929 GnRH secretion
    24654 (Plcb1)
   04912 GnRH signaling pathway
    24654 (Plcb1)
   04915 Estrogen signaling pathway
    24654 (Plcb1)
   04921 Oxytocin signaling pathway
    24654 (Plcb1)
   04926 Relaxin signaling pathway
    24654 (Plcb1)
   04935 Growth hormone synthesis, secretion and action
    24654 (Plcb1)
   04918 Thyroid hormone synthesis
    24654 (Plcb1)
   04919 Thyroid hormone signaling pathway
    24654 (Plcb1)
   04928 Parathyroid hormone synthesis, secretion and action
    24654 (Plcb1)
   04916 Melanogenesis
    24654 (Plcb1)
   04924 Renin secretion
    24654 (Plcb1)
   04925 Aldosterone synthesis and secretion
    24654 (Plcb1)
   04927 Cortisol synthesis and secretion
    24654 (Plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24654 (Plcb1)
   04270 Vascular smooth muscle contraction
    24654 (Plcb1)
  09154 Digestive system
   04970 Salivary secretion
    24654 (Plcb1)
   04971 Gastric acid secretion
    24654 (Plcb1)
   04972 Pancreatic secretion
    24654 (Plcb1)
   04973 Carbohydrate digestion and absorption
    24654 (Plcb1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24654 (Plcb1)
  09156 Nervous system
   04724 Glutamatergic synapse
    24654 (Plcb1)
   04725 Cholinergic synapse
    24654 (Plcb1)
   04728 Dopaminergic synapse
    24654 (Plcb1)
   04726 Serotonergic synapse
    24654 (Plcb1)
   04720 Long-term potentiation
    24654 (Plcb1)
   04730 Long-term depression
    24654 (Plcb1)
   04723 Retrograde endocannabinoid signaling
    24654 (Plcb1)
  09157 Sensory system
   04742 Taste transduction
    24654 (Plcb1)
   04750 Inflammatory mediator regulation of TRP channels
    24654 (Plcb1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24654 (Plcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24654 (Plcb1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24654 (Plcb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24654 (Plcb1)
   05142 Chagas disease
    24654 (Plcb1)
   05143 African trypanosomiasis
    24654 (Plcb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24654 (Plcb1)
   05016 Huntington disease
    24654 (Plcb1)
   05017 Spinocerebellar ataxia
    24654 (Plcb1)
   05022 Pathways of neurodegeneration - multiple diseases
    24654 (Plcb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24654 (Plcb1)
   05415 Diabetic cardiomyopathy
    24654 (Plcb1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24654 (Plcb1)
   04934 Cushing syndrome
    24654 (Plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24654 (Plcb1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     24654 (Plcb1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    24654 (Plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    24654 (Plcb1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 24654
NCBI-ProteinID: NP_001071109
RGD: 3344
Ensembl: ENSRNOG00000004810
UniProt: P10687
Position
3
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFETSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETSSEAPSETRTTPAENGVNHTATLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQMELEQEYQDKFKRLPLEILEFVQEAMKGKVSEDSNHGSAPPSLASDPAKVNLKSPSS
EEVQGENAGREFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggctggggctcagcccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactatagttactcca
attattttgaggaccgatcctcagggatttttcttttactggacagatcagaataaggag
acggagctgttagatctcagcctcgtcaaggatgccaggtgtgggaagcacgccaaagct
cccaaggaccccaagttacgtgaacttctggatgttgggaacatcggacacttggaacag
cgcatgataactgtggtgtatgggccagacctggtgaatatctcccacctgaatcttgtg
gcttttcaagaggaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggctcagaacatgtccagggacgcatttctggagaaagcatatactaagctcaag
cttcaggtgaccccagaagggcgcattcctcttaaaaacatctatcgactgttttcggca
gaccggaagcgagtggaaactgcgctagaggcttgtagtcttccatcgtcaaggaacgat
tccatccctcaagaggactttactccagatgtatacagagttttcctgaacaatctttgt
ccccgacctgaaattgataacatcttctctgaatttggtgccaaaagcaaaccgtacctt
actgttgatcagatgatggattttatcaaccttaagcagagagatccccggctgaatgaa
atactttacccacctctgaagcaagagcaggtccaagtgttgattgagaagtacgagccc
aacagcagcctcgccaagaaagggcagatgtcagtggatggattcatgcgctacctgagc
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaacgaagacatgtctcag
cccctgtctcactatttcatcaattcctcacacaacacctacctcacagctggccagttg
gctgggaactcgtctgtagagatgtatcgccaggtgcttctgtctggatgtcgctgtgtg
gagctggactgctggaagggcaggaccgctgaggaagagcctgtcatcacccatggattc
accatgacaacagaaatatccttcaaggaagtcatagaagccatcgcagagtgtgcgttc
aagacttctccttttcccatcctcctttcctttgagaaccatgtggattccccgaagcaa
caagccaagatggccgagtattgccgattaatctttggtgatgccctccttatggagcca
ctggaaaaatacccactggaatctggggtacctcttccaagccctatggatttaatgtat
aaaatcttggtgaaaaacaagaagaagtcacacaagtcgtcagagggaagtggtaaaaag
aagctctctgagcaagcttccaacacgtacagcgactcttccagcgtgttcgagccttcg
tctccgggagctggggaagcagatacggagagtgatgacgatgacgacgatgatgactgt
aaaaagtcttccatggatgaggggactgctggcagcgaggccatggccacagaagagatg
tctaacctggtgaactatattcagcctgtcaagtttgagtcctttgaaacttcaaaaaaa
agaaataaaagctttgaaatgtcttccttcgtggaaaccaaaggactcgaacaactcacg
aagtctccagttgaatttgtcgaatacaacaagatgcagcttagcaggatatatcccaaa
ggaacacgcgtggactcatccaactacatgcctcagctcttctggaatgctggctgtcag
atggtggcgctcaacttccagacagtggatctagctatgcagataaacatgggcatgtac
gaatacaatgggaagagtggctacaggctgaagccagagttcatgaggaggccagacaag
cattttgatccatttactgaaggaatcgtagatgggatagtggccaacactttatctgtt
aagattatttcaggtcagtttctctctgataagaaagttgggacttatgtggaagtggat
atgtttggtttgcctgtggacacaagaaggaaggcatttaaaaccaagacatcccaagga
aatgctgtaaatcctgtctgggaagaagagccaattgtattcaaaaaggtagttctgcct
tctctggcctgtttaaggatagcagcatatgaggaaggaggcaaatttattggccaccgg
atcttgcctgtgcaagcaattcggccaggctatcactacatctgcctgcggaatgagagg
aaccagcccctgatgctgccagctgtctttgtctacatagaagtcaaagactatgtccca
gacacgtatgcagatgtaattgaagcattatcaaacccaatccgatatgtcaatctgatg
gaacagagagctaagcagttggctgcattgacactggaggatgaagaggaagtcaagaag
gaggctgaccccggggaaacgtcatccgaggctccaagtgaaaccaggacaactccagca
gagaatggggtgaatcacaccgcaacccttgcacccaagccaccttcccaggctccacac
agccagcctgctccagggtctgtgaaggcacccgccaaaacagaggatctgattcagagc
gtgttaacagaagtagaggcgcagaccattgaagagctcaagcaacagaaatcgttcgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggtcaagagacaccacaagaaa
accaccgagctcatcaaggagcataccaccaagtacaatgagattcagaatgactacttg
agaaggagggcagccttggaaaagtccgccaaaaaggatagcaagaagaaatctgaaccc
agcagcccagatcatggctcatccgccattgagcaagacctcgcggccctggatgcagaa
atgactcagaagttgatagacttgaaagacaagcaacaacagcagctgcttaatcttcgg
caagagcagtattacagtgagaagtaccagaagcgggagcacattaaattgctcattcag
aagttgacagatgttgctgaagagtgtcagaacaatcagttgaagaagctgaaggaaatc
tgcgagaaagagaagaaggaattaaagaagaaaatggataagaagaggcaggagaagata
acagaagccaagtccaaagacaaaagccagatggaagaggagaagacagagatgatccga
tcatacatccaggaggtggtgcagtacatcaagaggttagaggaagcacaaagtaaaaga
caagaaaaacttgtggaaaaacacaaggagatccgccagcagatcctggatgagaagccc
aagctgcagatggagctggagcaagaataccaagacaagttcaaaagactgcccctggag
attctggagtttgtacaggaagccatgaaagggaaggttagtgaggacagcaatcacggc
tctgcccctccctcgctggcctcagaccctgctaaggtgaacctcaagtctccctccagt
gaggaggtacaaggagagaacgcgggaagagagtttgatactcctctgtga

KEGG   Rattus norvegicus (rat): 25031
Entry
25031             CDS       T01003                                 

Gene name
Plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    25031 (Plcb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25031 (Plcb4)
   04310 Wnt signaling pathway
    25031 (Plcb4)
   04371 Apelin signaling pathway
    25031 (Plcb4)
   04020 Calcium signaling pathway
    25031 (Plcb4)
   04070 Phosphatidylinositol signaling system
    25031 (Plcb4)
   04072 Phospholipase D signaling pathway
    25031 (Plcb4)
   04071 Sphingolipid signaling pathway
    25031 (Plcb4)
   04022 cGMP-PKG signaling pathway
    25031 (Plcb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    25031 (Plcb4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25031 (Plcb4)
   04613 Neutrophil extracellular trap formation
    25031 (Plcb4)
   04621 NOD-like receptor signaling pathway
    25031 (Plcb4)
   04062 Chemokine signaling pathway
    25031 (Plcb4)
  09152 Endocrine system
   04911 Insulin secretion
    25031 (Plcb4)
   04922 Glucagon signaling pathway
    25031 (Plcb4)
   04929 GnRH secretion
    25031 (Plcb4)
   04912 GnRH signaling pathway
    25031 (Plcb4)
   04915 Estrogen signaling pathway
    25031 (Plcb4)
   04921 Oxytocin signaling pathway
    25031 (Plcb4)
   04926 Relaxin signaling pathway
    25031 (Plcb4)
   04935 Growth hormone synthesis, secretion and action
    25031 (Plcb4)
   04918 Thyroid hormone synthesis
    25031 (Plcb4)
   04919 Thyroid hormone signaling pathway
    25031 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    25031 (Plcb4)
   04916 Melanogenesis
    25031 (Plcb4)
   04924 Renin secretion
    25031 (Plcb4)
   04925 Aldosterone synthesis and secretion
    25031 (Plcb4)
   04927 Cortisol synthesis and secretion
    25031 (Plcb4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25031 (Plcb4)
   04270 Vascular smooth muscle contraction
    25031 (Plcb4)
  09154 Digestive system
   04970 Salivary secretion
    25031 (Plcb4)
   04971 Gastric acid secretion
    25031 (Plcb4)
   04972 Pancreatic secretion
    25031 (Plcb4)
   04973 Carbohydrate digestion and absorption
    25031 (Plcb4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    25031 (Plcb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    25031 (Plcb4)
   04725 Cholinergic synapse
    25031 (Plcb4)
   04728 Dopaminergic synapse
    25031 (Plcb4)
   04726 Serotonergic synapse
    25031 (Plcb4)
   04720 Long-term potentiation
    25031 (Plcb4)
   04730 Long-term depression
    25031 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    25031 (Plcb4)
  09157 Sensory system
   04742 Taste transduction
    25031 (Plcb4)
   04750 Inflammatory mediator regulation of TRP channels
    25031 (Plcb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25031 (Plcb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25031 (Plcb4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    25031 (Plcb4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25031 (Plcb4)
   05142 Chagas disease
    25031 (Plcb4)
   05143 African trypanosomiasis
    25031 (Plcb4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25031 (Plcb4)
   05016 Huntington disease
    25031 (Plcb4)
   05017 Spinocerebellar ataxia
    25031 (Plcb4)
   05022 Pathways of neurodegeneration - multiple diseases
    25031 (Plcb4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25031 (Plcb4)
   05415 Diabetic cardiomyopathy
    25031 (Plcb4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25031 (Plcb4)
   04934 Cushing syndrome
    25031 (Plcb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25031 (Plcb4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     25031 (Plcb4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    25031 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    25031 (Plcb4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Other DBs
NCBI-GeneID: 25031
NCBI-ProteinID: NP_077329
RGD: 3345
Ensembl: ENSRNOG00000033119
UniProt: Q9QW07
Position
3
AA seq 1176 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRLAAIPKDPKILAALESVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPE
ITKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTSGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESAADQEEEAHPEYKFGNELSADDFSHKEAVANSVKKGL
VTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESV
GLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQ
LNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIG
TYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNN
KLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPK
KFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTA
ALGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCT
QVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTSDHKSKVKEIVAQ
HTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAH
QAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKV
QLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3531 nt   +upstreamnt  +downstreamnt
atggccaaaccttacgaatttaactggcagaaggaggtaccctctttcttgcaagaagga
gcagtttttgacagatatgaagaggaatctttcgtgtttgagcccaactgcctcttcaaa
gtggatgaattcggcttcttcctgacctggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagcattcggctggcagccataccaaaggatcccaaaatcctg
gctgctctcgagtctgttggaaaatctgaaaatgatctggaagggcggatattgtgtgtc
tgcagcggcacggatctggtgaatattggcttcacttacatggtggctgaaaacccagaa
ataactaagcaatgggtagaaggcctgagatcaatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaaacactggatgaaactggcctttctgaccaacaca
agtggcaaaatcccagtgaggagtattactagaaccttcgcatcagggaaaacagaaaag
gtgatctttcaagcactcaaggaattaggtctccccagtggaaagaatgatgaaattgaa
cctgctgcatttacctatgaaaagttctatgaactgacacagaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccgttttatgatgctaaaagagcaatgcagatcattgagatgtatgaacctgatgaagag
ttgaagaaaaaaggcctcatatccagtgatggattctgcagatatctcatgtcagatgaa
aatgcccccgtcttcctagatcgcttagaactttaccaggagatggaccaccccctggcc
cattacttcatcagttcctctcacaacacctatctcaccggccggcagtttggcggaaag
tcttcagtggaaatgtaccgacaagtcctcctggctggttgcaggtgtgtggaacttgac
tgttgggatggaaaaggtgaagatcaggaaccaataataactcacggaaaagcaatgtgt
acagacatcctttttaaggatgtaatccaggccatcaaggaaacagcgtttgtcacatca
gaatatcctgtaattctctcctttgaaaaccactgcagcaaatatcaacagtacaagatg
tccaagtattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcacat
ccacttgaaccagggaggcccttgccatctcctaatgacctcaaaagaaaaatactcatc
aaaaataaaaggctgaagcctgaagttgaaaaaaaacagctggaggctttgaaaagcatg
atggaggctggagaatcagctgccccggccagcatcttggaagatgacaatgaggaggaa
atagaaagcgcagctgatcaagaggaagaagcccaccctgaatacaagtttggaaatgaa
ctttctgccgatgacttcagtcacaaggaagcggttgcaaacagcgtcaagaagggcctg
gtcaccgtagaagatgagcaggcatggatggcatcttataaatacgtaggtgctaccacg
aatatccatccgtacttgtccacgatgatcaactatgcacagcctgtgaagtttcaaggt
ttccatgtggctgaagagcgcaacattcattataacatgtcttcttttaacgagtcggtt
ggccttggctacttgaagacgcacgcgattgagtttgtaaattacaataagcgacaaatg
agccgcatttaccccaagggaggccgagttgattccagtaattacatgcctcagattttc
tggaacgctggttgccagatggtttcactgaactatcaaaccccagatttagcgatgcaa
ttgaatcaaggaaaatttgagtataacggatcctgcggatacctcctcaagccagacttc
atgagacggcctgatcggacatttgatcccttctctgaaacccctgtggacggggttatt
gcagccacatgctcagtgcaggttatatcagggcagttcctgtcagataagaagatcggc
acatacgtggaagtcgatatgtacgggctgcccaccgacaccatacggaaggagttccga
acccgcatggttatgaacaatggactcaacccagtttacaatgaagaatcgttcgtgttt
cggaaggtgatcctgcctgacctggctgtcctgagaatcgctgtgtacgacgacaacaac
aagctcattggccagaggatccttcctctggatggcctccaggcaggctaccgacacatc
tccctgagaaatgagggaaacaaaccgttatcactgccaacaattttctgcaatatcgtt
cttaaaacatatgtgcctgatggatttggagatattgtggatgctctatccgatccaaag
aaattcctttcaatcacagagaagagagcagaccaaatgagagcaatgggcattgaaact
agtgacatagcagatgtgcccagtgacacttccaaaaatgacaagaaaggcaaggccaac
ccagccaaagcgaatgtaacccctcagagcagctctgagctcagaccaaccaccacagct
gccctgggctctggccaggaagccaagaaaggtattgaacttatccctcaagtgaggata
gaagatttaaagcaaatgaaggcttacttgaagcatttaaagaaacaacaaaaggagtta
aactctttaaagaagaaacacgcaaaggagcacagtaccatgcagaagttacactgcaca
caagtggacaaaatcgtggcccagtatgacaaggagaagtcgactcatgagaaaatccta
gagaaggccatgaagaagaaggggggaagtaattgccttgaaataaaaaaagaaacagaa
attaagattcagaccctgacatcggatcacaaatctaaggtcaaggagattgtggcgcag
cacacaaaggagtggtcagaaatgatcaacacgcacagcgccgaggagcaggaaatccgg
gacctgcacctgagccagcagtgtgagctgctgaggaagctgctcatcaacgctcatgag
cagcagacccagcagctgaagctctcccatgacagggaaagcaaagagatgcgagcccat
caggctaagatttctatggaaaatagcaaagccatcagtcaagataaatctatcaagaat
aaggcagaacgggagaggcgagtcagggagttgaacagcagcaacactaagaagtttcta
gaagaaagaaagagactggcaatgaagcagtcgaaagaaatggatcagttgaaaaaggtc
cagctggagcacctagaattcctagagaaacagaatgagcaggcgaaggagatgcagcag
atggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatga

KEGG   Rattus norvegicus (rat): 25738
Entry
25738             CDS       T01003                                 

Gene name
Plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04613  Neutrophil extracellular trap formation
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05135  Yersinia infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    25738 (Plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25738 (Plcg1)
   04014 Ras signaling pathway
    25738 (Plcg1)
   04015 Rap1 signaling pathway
    25738 (Plcg1)
   04370 VEGF signaling pathway
    25738 (Plcg1)
   04064 NF-kappa B signaling pathway
    25738 (Plcg1)
   04066 HIF-1 signaling pathway
    25738 (Plcg1)
   04020 Calcium signaling pathway
    25738 (Plcg1)
   04070 Phosphatidylinositol signaling system
    25738 (Plcg1)
   04072 Phospholipase D signaling pathway
    25738 (Plcg1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    25738 (Plcg1)
   04650 Natural killer cell mediated cytotoxicity
    25738 (Plcg1)
   04660 T cell receptor signaling pathway
    25738 (Plcg1)
   04658 Th1 and Th2 cell differentiation
    25738 (Plcg1)
   04659 Th17 cell differentiation
    25738 (Plcg1)
   04664 Fc epsilon RI signaling pathway
    25738 (Plcg1)
   04666 Fc gamma R-mediated phagocytosis
    25738 (Plcg1)
   04670 Leukocyte transendothelial migration
    25738 (Plcg1)
   04062 Chemokine signaling pathway
    25738 (Plcg1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    25738 (Plcg1)
   04919 Thyroid hormone signaling pathway
    25738 (Plcg1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25738 (Plcg1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25738 (Plcg1)
  09158 Development and regeneration
   04360 Axon guidance
    25738 (Plcg1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25738 (Plcg1)
   05206 MicroRNAs in cancer
    25738 (Plcg1)
   05205 Proteoglycans in cancer
    25738 (Plcg1)
   05231 Choline metabolism in cancer
    25738 (Plcg1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25738 (Plcg1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25738 (Plcg1)
   05214 Glioma
    25738 (Plcg1)
   05223 Non-small cell lung cancer
    25738 (Plcg1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    25738 (Plcg1)
   05171 Coronavirus disease - COVID-19
    25738 (Plcg1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25738 (Plcg1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25738 (Plcg1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    25738 (Plcg1)
   05022 Pathways of neurodegeneration - multiple diseases
    25738 (Plcg1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25738 (Plcg1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25738 (Plcg1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25738 (Plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25738 (Plcg1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     25738 (Plcg1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    25738 (Plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    25738 (Plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Other DBs
NCBI-GeneID: 25738
NCBI-ProteinID: NP_037319
RGD: 3347
Ensembl: ENSRNOG00000051490
UniProt: P10686
Structure
PDB: 

Position
3
AA seq 1290 aa
MAGVGTPCANGCGPSAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNTLRT
GERPELCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVT
FLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAILEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERASDASSQLFHVRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt   +upstreamnt  +downstreamnt
atggcgggcgtcgggaccccctgcgccaacggctgcgggcccagcgcgccctccgaagcg
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccagaacggaagaccttccaggtcaagttggagacgcgccagatc
acatggagccgcggtgcggacaaaatcgaggggtccatcgatatccgagaaatcaaggag
atccgcccagggaagacttcccgggactttgaccgctaccaagaagaccctgccttccgg
ccagatcagtcacactgttttgtcatcctctatggaatggaattccgcctgaagaccctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctc
atggaagatacgctgcaggccgccacacccctgcaaattgagagatggctccggaagcag
ttctactcagtggatcgtaaccgagaggatcgtatatcagccaaggacctgaagaacatg
ctgtcacaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
cttgaacagcgcagcggggacatcacctatgggcagtttgctcagctttaccgcagcctc
atgtacagcgcccagaagacgatggaccttccgttcttggaaaccaacactttgaggact
ggagagcggccagagctttgccaggtgtccctttctgagttccagcagttccttcttgag
taccagggggagctgtgggctgtcgaccggcttcaggtgcaggaatttatgctcagcttc
cttcgagaccccttgcgagagattgaggagccatacttcttcttggatgagcttgtcacc
tttctgttctccaaagagaacagtgtgtggaactcacagctggatgccgtgtgcccagaa
accatgaacaacccactgtctcactattggatctcttcctcgcataatacgtatctgact
ggggaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgaggatgggc
tgtcgctgcatcgagttggactgctgggatgggccagatgggatgccagtcatttaccat
gggcacaccctcaccaccaagattaagttctcagatgtcctgcacaccatcaaggagcac
gcgttcgtagcctcagagtaccctgtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagcacttcaggaaggtgctcggtgacacgctcctcaccaag
cccgtggacattgccgctgatgggctcccttctcccaaccagctcaagaggaagatcctg
attaagcataagaagctggctgagggcagtgcctatgaggaggtgcctacctctgtgatg
tactccgagaatgatatcagtaactccatcaagaatggtatcctctacttggaggacccc
gtgaatcatgagtggtacccccactactttgttctgactagcagcaagatctactactct
gaggagaccagcagtgaccagggaaatgaggatgaagaggagccgaaggaggccagtggc
agcacagagctgcactcgagcgagaagtggttccacgggaagctcggggctgggcgcgac
gggcggcacattgctgagcgcctgctcaccgagtactgcatagagactggggctcccgat
ggctccttcctagtgcgagaaagtgagaccttcgtgggggactacacgctgtctttctgg
cggaatgggaaagtccagcactgccgtatccactcccggcaggatgctgggactcctaag
ttcttcttgacagataaccttgtctttgactctctctatgacctcatcacacattatcag
caagtgcccctgcgctgcaatgagtttgagatgcgcctttcagagcctgttccacagacg
aatgcccatgagagcaaagagtggtaccacgcaagcctgactagagctcaggctgaacac
atgctgatgcgagtaccccgtgatggggccttcctggtgcggaagcgcaacgagcccaac
tcctatgccatctctttccgggctgagggaaagatcaagcactgccgagtacagcaggaa
ggccagactgtgatgctggggaactctgagtttgacagcctggtcgacctcatcagctac
tatgagaagcatcccctgtaccgcaaaatgaaactgcgctaccccatcaacgaggaggcg
ctggagaagattgggacagctgaacccgattatggggcactgtatgagggccgcaaccct
ggtttctatgtggaggccaaccctatgccaactttcaagtgtgcagtaaaagctctcttc
gactacaaggcccagagagaggatgagctgacttttaccaagagcgccatcatccagaat
gtggaaaagcaagatggtggctggtggcgtggggactatggtgggaagaagcagctgtgg
ttcccctcaaactatgtggaagagatgatcaatccagcaatcctagagccggagagggag
catctggatgagaacagcccactgggggacttgctgcgaggggtcttagatgtgccagcc
tgccagatcgccattcgtcctgagggcaaaaacaaccggctcttcgtcttctccatcagc
atgccgtcagtggctcagtggtccctagacgttgccgctgactcacaggaggagttgcag
gactgggtgaaaaagatccgtgaagttgcccagactgcagatgccaggcttactgagggg
aagatgatggagaggaggaagaagatcgccttggagctctccgagctcgtggtctactgc
cggcctgttccctttgacgaagagaagattggcacagaacgcgcttgttaccgggacatg
tcctcctttccggaaaccaaggctgagaagtatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctctcgcatctaccctaagggtcagaggctggactcc
tccaattatgaccctctgcccatgtggatctgtggcagccagcttgtagctctcaatttt
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggctggtggacactgt
ggctatgtgctgcagccaagcaccatgagagatgaagcctttgacccctttgataagagc
agtctccgaggtctggagccctgtgtcatttgcattgaggtgctgggggccaggcatctg
ccgaagaatggccggggtattgtgtgtcctttcgtggagattgaagtggctggggcagag
tacgacagcaccaagcagaagacagagtttgtagtggacaatggactgaaccctgtgtgg
cctgcaaagcccttccacttccagatcagtaacccagagtttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaagacctg
gagttggcctccctgctcatcaagattgacattttccctgctaaggagaatggtgacctc
agccctttcagtggtacatccctaagggaacgggcctcagatgcctccagccagctgttc
catgtccgggcccgggaagggtcctttgaagccagataccagcagccatttgaagacttc
cgcatctcgcaggagcatctcgcagaccattttgacagtcgggaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

KEGG   Rattus norvegicus (rat): 29322
Entry
29322             CDS       T01003                                 

Gene name
Plcb3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    29322 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29322 (Plcb3)
   04310 Wnt signaling pathway
    29322 (Plcb3)
   04371 Apelin signaling pathway
    29322 (Plcb3)
   04020 Calcium signaling pathway
    29322 (Plcb3)
   04070 Phosphatidylinositol signaling system
    29322 (Plcb3)
   04072 Phospholipase D signaling pathway
    29322 (Plcb3)
   04071 Sphingolipid signaling pathway
    29322 (Plcb3)
   04022 cGMP-PKG signaling pathway
    29322 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    29322 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29322 (Plcb3)
   04613 Neutrophil extracellular trap formation
    29322 (Plcb3)
   04621 NOD-like receptor signaling pathway
    29322 (Plcb3)
   04062 Chemokine signaling pathway
    29322 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    29322 (Plcb3)
   04922 Glucagon signaling pathway
    29322 (Plcb3)
   04929 GnRH secretion
    29322 (Plcb3)
   04912 GnRH signaling pathway
    29322 (Plcb3)
   04915 Estrogen signaling pathway
    29322 (Plcb3)
   04921 Oxytocin signaling pathway
    29322 (Plcb3)
   04926 Relaxin signaling pathway
    29322 (Plcb3)
   04935 Growth hormone synthesis, secretion and action
    29322 (Plcb3)
   04918 Thyroid hormone synthesis
    29322 (Plcb3)
   04919 Thyroid hormone signaling pathway
    29322 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    29322 (Plcb3)
   04916 Melanogenesis
    29322 (Plcb3)
   04924 Renin secretion
    29322 (Plcb3)
   04925 Aldosterone synthesis and secretion
    29322 (Plcb3)
   04927 Cortisol synthesis and secretion
    29322 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29322 (Plcb3)
   04270 Vascular smooth muscle contraction
    29322 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    29322 (Plcb3)
   04971 Gastric acid secretion
    29322 (Plcb3)
   04972 Pancreatic secretion
    29322 (Plcb3)
   04973 Carbohydrate digestion and absorption
    29322 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29322 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    29322 (Plcb3)
   04725 Cholinergic synapse
    29322 (Plcb3)
   04728 Dopaminergic synapse
    29322 (Plcb3)
   04726 Serotonergic synapse
    29322 (Plcb3)
   04720 Long-term potentiation
    29322 (Plcb3)
   04730 Long-term depression
    29322 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    29322 (Plcb3)
  09157 Sensory system
   04742 Taste transduction
    29322 (Plcb3)
   04750 Inflammatory mediator regulation of TRP channels
    29322 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29322 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29322 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    29322 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29322 (Plcb3)
   05142 Chagas disease
    29322 (Plcb3)
   05143 African trypanosomiasis
    29322 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29322 (Plcb3)
   05016 Huntington disease
    29322 (Plcb3)
   05017 Spinocerebellar ataxia
    29322 (Plcb3)
   05022 Pathways of neurodegeneration - multiple diseases
    29322 (Plcb3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29322 (Plcb3)
   05415 Diabetic cardiomyopathy
    29322 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29322 (Plcb3)
   04934 Cushing syndrome
    29322 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29322 (Plcb3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     29322 (Plcb3)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    29322 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    29322 (Plcb3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 29322
NCBI-ProteinID: NP_203501
RGD: 61993
Ensembl: ENSRNOG00000021150
UniProt: Q45QJ4
Position
1
AA seq 1236 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGEALLIDPLDKYPLSAGTPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKTSLEPQKSLGE
EGLNRGPNVLMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGRFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTEMCQETPSQQ
QGSQLSSNPAPNPLDASPRWPPGPTTSPTSTSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSSSALSRATNVE
DVKEEEKEAARQYREFQNRQVQSLLELREAQADAETERRLEHLKQAQQRLREVVLDAHTT
QFKRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRR
LEEAQKQRHERLLAGQQQVLQQLVEEEPKLVAQLTQECQEQRERLPQEIRRCLLGETSEG
LGDGPLVACASNGHAAGSGGHQSGADSESQEENTQL
NT seq 3711 nt   +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaaattcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgagtggaccccaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccccaagattcgagaggtactgggctttgggggtcctgacacccggctggag
gagaaactgatgacagtggtagcaggaccagatccagtaaacaccacattcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaagctggctatg
aacatactggctcagaacgcctcccggaacacgttccttcggaaagcatacacgaaactg
aagctgcaggtgaaccaggatggacggattccagtcaagaacattctgaagatgttctcc
gcggacaagaagcgggtggagactgcactggagtcctgcggcctcaacttcaaccggagt
gagtccattcggcctgatgagttttccttggaaatcttcgagcggttcttgaataagctg
tgtctgcgaccggatattgacaagatcctgctggagataggtgctaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcaaagagacccaagactcaac
gaggtgctgtacccaccgcttcgctcctcacaggctcggctgctcattgagaagtatgag
ccgaacaaacagttcctggagcgcgaccagatgtctatggagggtttcagccgctatctg
ggaggggaggagaatggcatcctgcccctggaggccctggatctgagcatggacatgacg
cagccactgagcgcatacttcatcaattcttcacacaatacctatctcactgcgggccag
ctggctggaacatcgtcagtggagatgtaccgccaggcgctgctgtggggctgccgttgt
gtggagctggatgtatggaagggacggccaccggaggaagagcccttcattacccatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgttagaggccatcgccgagacagcc
ttcaagacctcaccctaccctgtcattctctccttcgaaaaccatgtggactcggcaaaa
cagcaggccaagatggcagagtactgccgctctatctttggggaagcgctgctcattgac
ccactggacaagtacccgctgtctgcgggcaccccccttcctagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcggcatcggcccagcacaggtgtccctgacagc
tccgtgcgcaagcggcctctggaacagagcaattcagccctgagtgagagctcagctgcc
acagagccctcctcaccccagctggggtcccccagctctgacagctgccctggcctaagc
aatggggaagaggtgggacttgagaagaccagcctggagcctcagaagtctctaggtgag
gagggcctcaaccgaggacctaatgttctcatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaggaggaaacaacggatccaaaaaagcccaccaccgatgagggcaca
gccagcagtgaggtcaacgccacagaggagatgtcgacactcgtcaattacgttgagccc
gtcaagttcaagtcctttgaggctgctcgaaaaaggaacaagtgctttgagatgtcgtcc
tttgtggagaccaaggcgatggagcagctgaccaagagccccatggagttcgtggaatac
aacaaacagcagcttagtcgcatctaccccaagggcacccgtgtggactcctccaactac
atgcctcagctcttctggaacgtgggctgtcagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaacgggcgcagtgggtacttg
ctcaagcctgagtttatgcggcggccggacaagtcttttgaccccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagtttctgtct
gacaggaaggtgggcatctatgtcgaggtggacatgtttggtctcccagttgacacaaga
cgcaaatatcgcacacggacatcccaggggaactcattcaaccctgtgtgggatgaagaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcacttcgcattgcagccttt
gaggagggtggcagatttgttgggcatcgtatcctgcctgtctctgctatccgctcagga
taccactacgtctgcctgcgaaatgaggccaaccaaccgttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
atcaaccccatcaagcacgtcagcctaatggaccagcgggccaagcaactggctgctctc
attggggagagtgaggctcaggccagtacagaaatgtgtcaggagaccccgtctcaacag
caaggctcacagctctcctccaaccccgcacctaacccactggatgcctcacctcgatgg
cccccaggtcctaccacctcccccactagcacctccctcagtagcccagggcagcgagat
gatctgatcgccagcatcctttctgaggtgaccccaacacccctagaggagctccgaagc
cacaaggctatggtgaagctccggagccggcaggatcgagacctgagggaactgcataaa
aaacaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcctccagcgccctgagcagggccaccaatgtggaa
gacgtgaaggaggaagaaaaagaggcagccagacagtatcgagagttccagaaccgacaa
gtacagagcctgctggagctgagggaggcccaggcagatgcagagacagaacggaggctg
gagcatctgaaacaggctcagcagcggctcagggaggttgtcctggacgcacatacgact
cagttcaagaggctgaaggagttgaatgaaagggagaagaaggagcttcagaagatcctg
gacaggaagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggag
gtggaactgacagagatcaatcggaggcacatcactgagtcagtgaactccatcaggagg
ctggaagaggcccagaagcagcgccacgaacgcctcttggcagggcaacagcaggtcctc
cagcagctagtggaagaggagcccaagctggtggcccagctgacccaggagtgtcaggaa
cagcgagagaggctgccccaggagatccgtcggtgcctgctgggcgagacatcagaggga
ttgggggatggccccctggtggcctgtgccagcaatggtcatgcagctgggagtggtggg
caccagtccggcgctgactcggagagccaggaggaaaacacccagctttga

KEGG   Rattus norvegicus (rat): 29337
Entry
29337             CDS       T01003                                 

Gene name
Plcg2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04020  Calcium signaling pathway
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    29337 (Plcg2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    29337 (Plcg2)
   04014 Ras signaling pathway
    29337 (Plcg2)
   04370 VEGF signaling pathway
    29337 (Plcg2)
   04064 NF-kappa B signaling pathway
    29337 (Plcg2)
   04066 HIF-1 signaling pathway
    29337 (Plcg2)
   04020 Calcium signaling pathway
    29337 (Plcg2)
   04070 Phosphatidylinositol signaling system
    29337 (Plcg2)
   04072 Phospholipase D signaling pathway
    29337 (Plcg2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29337 (Plcg2)
   04613 Neutrophil extracellular trap formation
    29337 (Plcg2)
   04625 C-type lectin receptor signaling pathway
    29337 (Plcg2)
   04650 Natural killer cell mediated cytotoxicity
    29337 (Plcg2)
   04662 B cell receptor signaling pathway
    29337 (Plcg2)
   04664 Fc epsilon RI signaling pathway
    29337 (Plcg2)
   04666 Fc gamma R-mediated phagocytosis
    29337 (Plcg2)
   04670 Leukocyte transendothelial migration
    29337 (Plcg2)
   04062 Chemokine signaling pathway
    29337 (Plcg2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    29337 (Plcg2)
   04919 Thyroid hormone signaling pathway
    29337 (Plcg2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    29337 (Plcg2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29337 (Plcg2)
  09158 Development and regeneration
   04360 Axon guidance
    29337 (Plcg2)
   04380 Osteoclast differentiation
    29337 (Plcg2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29337 (Plcg2)
   05206 MicroRNAs in cancer
    29337 (Plcg2)
   05205 Proteoglycans in cancer
    29337 (Plcg2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    29337 (Plcg2)
   05214 Glioma
    29337 (Plcg2)
   05223 Non-small cell lung cancer
    29337 (Plcg2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29337 (Plcg2)
   05171 Coronavirus disease - COVID-19
    29337 (Plcg2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29337 (Plcg2)
   05169 Epstein-Barr virus infection
    29337 (Plcg2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29337 (Plcg2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    29337 (Plcg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29337 (Plcg2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     29337 (Plcg2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    29337 (Plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    29337 (Plcg2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 29337
NCBI-ProteinID: NP_058864
RGD: 3348
Ensembl: ENSRNOG00000051986
UniProt: P24135
Structure
PDB: 
2EOB

Position
19
AA seq 1265 aa
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFSARKSTPERRTVQMIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRHKADCCFTIFYGTQFVLSTLSLATDSKEDAV
KWLSGLKILHQEAMNASTPTMIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSGI
KFLKDKLVEIGAQKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLQDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRAGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKEVLGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKTQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEDPVQDTPPTELHFGEKWFHKKVESR
TSAEKLLQEYCAETGAKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGVMKYY
LTDNLTFNSIYALIQHYREAHLRCAEFELRLTDPVPNPNPHESKPWYYDRLSRGEAEDML
MRIPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAGDAEEMEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWERNQSIAIELSDLVVYCKPTSKTKDHLENPDFREIRSFVE
TKADSIVRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDSNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFLVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRGANRDALVKEFNVNENQLRLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggtcaacgtggacacccttccagaatatgagaagagtcagatcaagaga
gccctggagctagggacggtgatgaccgtattcagtgcccgcaaatccaccccagagcgg
aggacagtacagatgatcatggagacccggcaggtggcatggagcaagacagcagataag
atcgaaggcttcttggacatcatggaaataaaggaaatccggccagggaagaactccaag
gactttgagcgagccaaggctgtccgtcacaaggcagactgctgcttcaccatcttctac
ggcacccagttcgtgctcagcactctcagtctggcaaccgactcaaaggaggatgcagtg
aagtggctctctggcttgaagatcttacaccaggaagcgatgaacgcatccactcccaca
atgattgagagttggctgcggaaacagatttattcagtagatcaaacccgaagaaacagc
atcagcctccgggagctgaagaccatcttgcccctggtcaacttcaaagtgagcggcatc
aagttcctcaaggacaagctggtggaaattggcgcccagaaagatgagctcagttttgaa
cagttccatctcttctataaaaaactcatgtttgagcagcagaagtcgatacttgacgaa
ttcaaaaaagactcctccgtgttcatcctagggaacacagaccggcctgatgcctcagcc
gtctacctgcaagacttccagaggtttcttttacatgaacagcaggagctatgggctcag
gatctgaacaaagtccgggagcggatgaccaagtttatcgatgacacaatgagggagacc
gcagagcccttcttgtttgtggatgagttcctcacgtatctgttctcacgggagaacagc
atctgggacgagaagtacgatgccgtggacatgcaggacatgaacaaccccttgtcccat
tactggatctcctcttcccacaacacgtacctcactggagaccagctgcgtagcgagtcc
tccacggaagcgtatatccgctgtctgcgtgctggttgtcgctgcatcgagttggattgc
tgggatgggcctgacgggaaacccataatctatcacggttggacacggaccaccaagatc
aagtttgatgatgttgttcaggccatccgggatcatgcctttgttacctccagctttccc
gtgattctgtctatcgaggagcactgcagtgtggagcagcaacgtcacatggccaaggtc
ttcaaggaagtgttaggagacctgctgttgacgaagcccacggaggccagtgctgaccag
ctgccctcacccagccagcttcgtgagaagatcattatcaagcataagaagctgggcccc
cgaggtgatgtcgatgtcaatgtggaggacaagaaagatgagcacaagacccagggcgag
ctgtatatgtgggactccatcgaccagaaatggactcgccactactgtgctattgcggac
gccaagctgtccttcagtgacgacattgaacagactgtggaagaggatccggtccaggac
actccccccacggagctacattttggggagaaatggttccataagaaggtggagagcagg
accagtgcggagaagctgctgcaggagtactgtgccgagactggggccaaggatggcacc
ttcctggtgcgggagagcgagaccttccccaacgactacacactctccttctggcggtct
ggccgggtgcagcactgccgaatccggtctaccatggagggtggggtcatgaagtactac
ctgactgacaacctcacgttcaacagcatctacgccctcatccagcactaccgggaggca
cacctgcgctgtgcggagttcgagctgcggctcacagacccggtgcccaaccccaaccca
catgagtccaagccgtggtactatgacaggctgagcaggggggaagcagaggacatgttg
atgcggattccccgagatggagccttcctcattcggaagcgggaggggaccgactcttac
gccatcaccttcagggccaggggcaaggtgaaacattgccgtatcaaccgggacggacgt
cactttgtgctggggacctctgcctactttgagagcctggtggagctcgtcagctactat
gagaagcacgcactctaccgcaagatgaggcttcgctaccccgtgaccccggagctcctg
gaacgatataatatggaaagagacatcaactctctctatgacgtcagcaggatgtatgtg
gacccaagtgagatcaacccttccatgcctcagaggactgtgaaagcactctatgactac
aaagccaagcgcagcgatgagctgaccttctgccgaggtgccctcatccacaacgtctcc
aaggagccgggaggatggtggaaaggggactatgggacccggatccagcagtatttccca
tctaactacgttgaagatatctcggcaggcgatgctgaggagatggaaaagcagattatt
gaagacaaccccctcgggtctctctgcagaggcatattggatcttaatacctacaatgtg
gtgaaggccccccaggggaaaaaccagaaagccttcgtctttatcctggagcctaagaaa
cagggggaccctcctgtggagttcgcgactgaccgtgtggaggaactgtttgagtggttt
cagagtatacgagagatcacttggaagatcgacaccaaggagaacaacatgaagtactgg
gagaggaatcagtccattgctattgagctctctgacttggttgtgtactgcaagccgact
agcaaaaccaaggaccatttggaaaatcctgacttccgggaaattcgctcttttgtggag
acaaaggcagacagcattgtcaggcaaaagcccgtggatctattgcggtacaaccagaag
ggcctgacccgtgtctaccccaagggacagagagttgactcttccaactacgaccccttc
cgtctgtggctgtgtggctcccagatggtggcgctcaatttccagactccagacaagtac
atgcagatgaaccatgcattgttttcgctcaatgggcggacaggttacgtcctgcagccc
gagagcatgcggtctgagaagtatgacccgatgcccccggagtcccagaggaagatcctg
atgacactcactgtcaaggttcttggtgcacgccacctccctaaactagggcggagtatc
gcctgtccctttgtagaggtggaaatctgtggggccgagtatgacagcaacaaattcaag
acgacggttgtgaatgacaacggtctcagccctgtctgggctccaactcaggagaaggtg
acatttgaaatttatgacccaaaccttgcgttcctacgctttctggtctacgaagaagac
atgttcagtgaccccaacttcctggctcatgccacataccccattaaaggcatcaaatca
ggatttagatcagtccctctgaagaacgggtacagtgaagacatcgagctggcatccctc
ctggttttctgtgagatgcggccagtcctggagagtgaagaagaactctattcctcctgt
cgccagctgcggaggcggcaggaagagctcaacaaccagctcttcctgtatgacacacac
cagaacctgcgaggagccaaccgggatgccctggtgaaggagttcaatgttaacgagaat
cagctgcggctgtaccaggagaagtgtaaccggaggctgagagagaagagagtgagtaac
agcaggttctactcctag

KEGG   Rattus norvegicus (rat): 85240
Entry
85240             CDS       T01003                                 

Gene name
Plcb2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04742  Taste transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    85240 (Plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    85240 (Plcb2)
   04310 Wnt signaling pathway
    85240 (Plcb2)
   04371 Apelin signaling pathway
    85240 (Plcb2)
   04020 Calcium signaling pathway
    85240 (Plcb2)
   04070 Phosphatidylinositol signaling system
    85240 (Plcb2)
   04072 Phospholipase D signaling pathway
    85240 (Plcb2)
   04071 Sphingolipid signaling pathway
    85240 (Plcb2)
   04022 cGMP-PKG signaling pathway
    85240 (Plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    85240 (Plcb2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    85240 (Plcb2)
   04613 Neutrophil extracellular trap formation
    85240 (Plcb2)
   04621 NOD-like receptor signaling pathway
    85240 (Plcb2)
   04062 Chemokine signaling pathway
    85240 (Plcb2)
  09152 Endocrine system
   04911 Insulin secretion
    85240 (Plcb2)
   04922 Glucagon signaling pathway
    85240 (Plcb2)
   04929 GnRH secretion
    85240 (Plcb2)
   04912 GnRH signaling pathway
    85240 (Plcb2)
   04915 Estrogen signaling pathway
    85240 (Plcb2)
   04921 Oxytocin signaling pathway
    85240 (Plcb2)
   04926 Relaxin signaling pathway
    85240 (Plcb2)
   04935 Growth hormone synthesis, secretion and action
    85240 (Plcb2)
   04918 Thyroid hormone synthesis
    85240 (Plcb2)
   04919 Thyroid hormone signaling pathway
    85240 (Plcb2)
   04928 Parathyroid hormone synthesis, secretion and action
    85240 (Plcb2)
   04916 Melanogenesis
    85240 (Plcb2)
   04924 Renin secretion
    85240 (Plcb2)
   04925 Aldosterone synthesis and secretion
    85240 (Plcb2)
   04927 Cortisol synthesis and secretion
    85240 (Plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    85240 (Plcb2)
   04270 Vascular smooth muscle contraction
    85240 (Plcb2)
  09154 Digestive system
   04970 Salivary secretion
    85240 (Plcb2)
   04971 Gastric acid secretion
    85240 (Plcb2)
   04972 Pancreatic secretion
    85240 (Plcb2)
   04973 Carbohydrate digestion and absorption
    85240 (Plcb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    85240 (Plcb2)
  09156 Nervous system
   04724 Glutamatergic synapse
    85240 (Plcb2)
   04725 Cholinergic synapse
    85240 (Plcb2)
   04728 Dopaminergic synapse
    85240 (Plcb2)
   04726 Serotonergic synapse
    85240 (Plcb2)
   04720 Long-term potentiation
    85240 (Plcb2)
   04730 Long-term depression
    85240 (Plcb2)
   04723 Retrograde endocannabinoid signaling
    85240 (Plcb2)
  09157 Sensory system
   04742 Taste transduction
    85240 (Plcb2)
   04750 Inflammatory mediator regulation of TRP channels
    85240 (Plcb2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    85240 (Plcb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    85240 (Plcb2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    85240 (Plcb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    85240 (Plcb2)
   05142 Chagas disease
    85240 (Plcb2)
   05143 African trypanosomiasis
    85240 (Plcb2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85240 (Plcb2)
   05016 Huntington disease
    85240 (Plcb2)
   05017 Spinocerebellar ataxia
    85240 (Plcb2)
   05022 Pathways of neurodegeneration - multiple diseases
    85240 (Plcb2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    85240 (Plcb2)
   05415 Diabetic cardiomyopathy
    85240 (Plcb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    85240 (Plcb2)
   04934 Cushing syndrome
    85240 (Plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    85240 (Plcb2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     85240 (Plcb2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    85240 (Plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    85240 (Plcb2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2
Other DBs
NCBI-GeneID: 85240
NCBI-ProteinID: NP_445930
RGD: 621004
Ensembl: ENSRNOG00000058337
UniProt: O89040
Position
3
AA seq 1183 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETSIASPVILRVDPKGYYLYWTHQSKEMEFLD
VTSIRDTRFGKFAKIPKSQKLREVFNMDFPDNHFLLKTFTVVSGPDMVGLTFHNFVSYKE
NVGKDWAEDVLALAKHPMTANASRSTFLDKILVKLKMQLSPEGKIPVKNFFQMFPADRKR
VEAALSACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPARPEQVQALIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAHDTLRIHQDMTQPLNHYFINSSHNTYLTAGQFSGPSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDILFKEAVEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGETLLTEPLENFPLKPGMPLPSPEDLRGKILIKNKKNQFSGPASPNKKPDGV
SEGGFPSSVPVEEDTGWTAEDRTEVEEGEEEEEVEEEEEEESGNLDEEEIKKMQSDEGTA
GLEVTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYLVSSFTELKAYELLSKASMQFVDYN
KRQMSRVYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLL
KHEFMRRQDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKR
RYRTKLSPTANSINPVWKEEPFIFEKILVPELASLRIAVMEEGGKFIGHRIIPINALHSG
YHHLCLRSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKYFSAHDKKSVKLKEV
TGSLPEKLFSGIPVASQSNGAPVSAGNGSTAPGTKAKEEATKEVAEPQTTSLEELRELKG
VVKLQRRHEKELRELERRGARRWEELLQRGAAQLAELQDPAASCKLRPGKGSRKKRIVPC
EETIVVPREVLEGPDPRVQDLKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAR
EKQAAELKSFKETSETDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQE
VVQAVKQMTETLERHQEKLEEKQTACLEQIQAMEKQFQEKALAEYEAKMKGLEAEVKESM
RACFKACFPTEAEEKPERPCEASEESCPQEPLVNKTDTQESRL
NT seq 3552 nt   +upstreamnt  +downstreamnt
atgtctttgctcaaccctgtcctgttgccccctaaggtgaaggcatatctgagccaaggg
gagcgcttcatcaagtgggacgatgaaacctcaatagcctcccctgttatccttcgggtg
gatcccaagggctattacttatactggacacatcaaagtaaggagatggaatttctggat
gtcacgagcatccgagacactcgctttgggaagtttgccaagatacccaagagccagaaa
ctccgggaggtattcaacatggactttccagacaaccacttcctgctgaaaacattcaca
gtggtatccggcccggacatggtgggcctcaccttccacaattttgtctcttacaaggag
aacgtaggcaaggattgggctgaggatgtactggctctggccaaacacccaatgacagcc
aatgcttctcgaagcacattcctagacaagatcctggtgaagcttaaaatgcagctgagc
cctgaagggaagatccctgtgaagaattttttccagatgtttcctgccgatcgcaaacgt
gtagaagctgccctcagtgcctgtcaccttgcaaaaggcaagaatgatgctatcaatccc
gaggacttcccagaatctgtgtacaagagcttcctcatgagcctctgtcctcggccagaa
attgatgagatcttcacttcttatcatgctaaagccaaaccctacatgaccaaggagcac
ctgaccaaattcatcaatcagaagcaacgagaccctcgactcaattccttgctgttccca
ccagcccggcctgagcaggtgcaggcgctcattgacaagtacgagcccagcggcatcaat
gtgcagaggggccaactgtcaccagagggcatggtctggtttctctgtggaccagagaac
agtgtcctggcccatgatactctgcggatccaccaagacatgacacagcctctgaatcac
tacttcatcaactcctcacacaacacctacctgacagctggccagttttcaggcccttcc
tcggctgagatgtaccgccaggtgctgctatctggctgccgttgtgtagaattagattgt
tggaaaggaaagccccccgacgaagaacccatcatcacccacggcttcactatgaccaca
gatatcttgttcaaggaagcagtcgaagccattgcagaaagtgcctttaagacctcccca
tatcctgtcatcctgtcatttgaaaaccacgtggactcaccccgccaacaggctaagatg
gccgagtactgccggaccatgtttggagagaccttgctcacagagcccctggaaaacttt
cctctgaaacctggcatgcctctgcctagccctgaggacctccggggcaagatcctcatt
aagaataagaagaaccagttttctgggccagcatcccccaacaagaagcctgatggggtg
tctgagggcggcttcccatctagtgtccctgtagaagaggacacggggtggactgctgag
gaccggactgaggtggaggagggagaggaggaggaggaggtggaagaagaggaagaggag
gagtcaggaaacctggatgaagaagaaattaagaagatgcagtctgatgagggcacagca
ggcttggaggtgacagcttatgaggaaatgtccagccttgtcaattacatccagcccacc
aagtttatctccttcgagttctctgcacagaagaacaggagttaccttgtctcttccttc
acggagctcaaggcctacgagctgctctccaaggcctccatgcagtttgtggactataat
aaacgccagatgagccgcgtgtaccccaagggcacgcgcatggactcttccaactacatg
ccccagatgttctggaatgccggatgtcagatggttgccctcaatttccagacaatggat
ctgcccatgcagcagaacatggcactgtttgagttcaacgggcagagtggctacctccta
aagcacgagttcatgcgcaggcaggacaagcagttcaaccccttctcggtggaccgcatt
gatgtggtggttgccactaccctttccattacggtcatctctgggcagttcctgtcagag
cgcagtgtgcgcacctatgtggaagtagaactgtttggcctcccaggggaccccaagagg
cgctatcgtaccaagctgtcacctactgctaactccatcaatcctgtctggaaggaggaa
cccttcatttttgagaagatcttggtgcctgagctggcctccctcaggatagctgtaatg
gaagaaggcggcaaatttattggacatcgcatcatccccatcaatgccttacattccgga
taccaccatctgtgcctgcgcagtgagagcaacatgcctctcaccatgcctgctctcttc
gtcttcctggagatgaaggactatgtacctgacacgtgggcagatcttactgtggctctt
gccaaccccatcaagtacttcagtgcccatgataagaagtctgtgaagctcaaagaagtg
acaggaagtctgcctgagaagctcttctctgggattcctgttgccagccagtccaacggg
gctccagtctccgcaggcaatgggtcaacagcgcctgggaccaaggccaaggaggaagct
acgaaggaagtggcagagccacagaccactagcttggaagagctgcgggagctgaagggc
gtggtgaagctgcagcggagacatgagaaggagcttcgagagctggagcggcgtggagcc
cggcgctgggaggagctgctgcagcgtggcgctgcacagctagcggagctccaggaccca
gcagcaagctgcaagctccgcccgggcaagggctcccgcaagaagaggatcgtgccctgt
gaggagaccatcgtggtgcctagggaggtcctcgagggaccggacccccgcgtgcaggat
ctgaaggacaggctggagcaggagctgcagcagcaaggcgaggagcagtaccgctctgtc
ctcaagcgtaaggagcagcacgtgaccgagcaaatcgccaagatgatggagctggccaga
gagaaacaggctgctgaactcaagagcttcaaggagacctcggaaactgacaccaaagag
atgaagaaaaaactggaggccaaaaggctggagcggatccaagccatgaccaaagtcacc
acagacaaggtggcccaggagaggctcaagagagaaattaacaactcccacatccaggag
gtggtgcaggctgtcaagcagatgacagagaccctggagcgtcaccaggagaagctggaa
gagaagcagacagcctgcctggagcagatccaggcaatggaaaagcagttccaggagaag
gcgctggcagagtatgaggccaagatgaagggcctggaggctgaagtaaaggagtcaatg
cgggcttgcttcaaggcctgcttccccacggaagcagaagagaagcctgagaggccctgt
gaggcctctgaggagtcgtgtccacaggagccacttgtgaacaagacagacactcaggag
agccgcctctga

DBGET integrated database retrieval system