KEGG   Rattus norvegicus (rat): 24655
Entry
24655             CDS       T01003                                 

Gene name
Plcd1, Plc1
Definition
(RefSeq) phospholipase C, delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    24655 (Plcd1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24655 (Plcd1)
   04070 Phosphatidylinositol signaling system
    24655 (Plcd1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    24655 (Plcd1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24655 (Plcd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24655 (Plcd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     24655 (Plcd1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    24655 (Plcd1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    24655 (Plcd1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 Tail_P2_I TEP1_N
Other DBs
NCBI-GeneID: 24655
NCBI-ProteinID: NP_058731
RGD: 3346
Ensembl: ENSRNOG00000032238
UniProt: P10688
Structure
PDB: 

Position
8q32
AA seq 756 aa
MDSGRDFLTLHGLQDDPDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
SPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMNFKELKDFLKELNIQVDDGY
ARKIFRECDHSQTDSLEDEEIETFYKMLTQRAEIDRAFEEAAGSAETLSVERLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDG
VTTSLPSPEQLKGKILLKGKKLGGLLPAGGENGSEATDVSDEVEAAEMEDEAVRSQVQHK
PKEDKLKLVPELSDMIIYCKSVHFGGFSSPGTSGQAFYEMASFSESRALRLLQESGNGFV
RHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCG
YVLKPAFLRDPNTTFNSRALTQGPWWRPERLRVRIISGQQLPKVNKNKNSIVDPKVIVEI
HGVGRDTGSRQTAVITNNGFNPRWDMEFEFEVTVPDLALVRFMVEDYDSSSKNDFIGQST
IPWNSLKQGYRHVHLLSKNGDQHPSATLFVKISIQD
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggactcgggtagggacttcctgaccctgcacgggctccaggatgacccggaccttcag
gcccttctgaagggcagccagcttctgaaggtgaagtccagctcgtggcgtagggaacgc
ttctacaagctacaggaggactgcaagaccatctggcaggaatctcgaaaggtcatgagg
tccccggagtcgcagctgttctccatcgaggacattcaggaggtacggatgggacaccgc
acagaaggcctggagaagtttgcccgagacatccccgaggatcgatgcttctccattgtc
ttcaaggaccagcgcaacaccctagacctcattgccccatcaccagctgacgctcagcac
tgggtgcagggcctgcgcaagatcatccaccactccggctccatggaccagcggcagaag
ctgcagcactggattcactcctgcttgcgaaaggctgataaaaacaaggacaacaagatg
aacttcaaggagctgaaggacttcctgaaggagctcaacatccaggtggatgacggctac
gccaggaagatcttcagggaatgtgaccactcccagacagactcgctggaggatgaggag
attgagaccttctacaagatgctgacccagcgcgcagagatcgaccgtgcttttgaggag
gccgcaggatccgcggagaccctgtcggtggagaggctagtgacgtttctgcagcaccag
cagcgggaggaggaggcagggccagccttggccctctctctcattgagcgctacgagccc
agtgagactgccaaggcccagcggcagatgaccaaggatggcttcctcatgtacttgctg
tcggctgacggtaacgccttcagcctggcacaccgccgtgtctaccaggacatggaccag
ccactgagtcactacttagtgtcttcttcccacaacacctacctgctggaagaccagctc
acagggcccagcagcacggaggcctacatccgggctctgtgcaaaggctgccggtgcttg
gagctcgactgctgggatggtcccaaccaggaacccatcatctaccacggctacactttt
acctctaagatacttttctgtgacgtgctcagggccatcagggactatgccttcaaggca
tccccctacccagtcatcctgtccctggagaaccactgtagcctggagcaacaacgagtc
atggcccgtcacctgagggctatcctggggcccatactgttggaccagccactggatggg
gttaccacgagcctgccttcacctgagcaactgaagggcaagatcctgttgaaagggaag
aagctgggagggctgctgcctgctggaggggagaatgggtccgaagccactgacgtgtct
gacgaggtagaggctgctgaaatggaggacgaggctgtgcgcagccaagtgcaacacaag
cccaaggaggataaactaaagctggtgccggagctctccgacatgatcatttactgcaag
agcgtccactttggtggcttctccagtcctggcacctctgggcaggcattctatgagatg
gcttccttctctgagagccgtgccctccggttgctgcaagaatcaggaaatggttttgtc
cgtcataacgtgagctgtctgagcaggatctacccggctgggtggagaacagattcctcc
aactacagtcctgtggagatgtggaacgggggctgccagattgttgctctgaacttccaa
acccctgggccagaaatggatgtttaccttggctgcttccaggacaatggaggctgtggg
tatgtgctgaaacccgcctttctgagagaccccaacaccaccttcaactcacgtgccctg
actcaggggccctggtggcgtccagagaggctccgtgtccggatcatctctggacagcag
ctgccaaaggtcaataagaataagaattctatcgtggaccccaaggtgatcgtggagatc
catggcgtgggccgggacaccggtagccgtcagacagcagttattaccaataatggtttc
aacccacggtgggacatggagtttgagtttgaggtaacagtgcctgaccttgccctcgta
cgcttcatggtagaggattatgattcctcttctaagaacgactttattggccagagtact
atcccctggaacagcctcaagcaggggtaccgccatgtccacctcttgtctaagaatgga
gaccagcatccatcagccacactttttgtgaagatctccatccaggactaa

DBGET integrated database retrieval system