KEGG   Rattus norvegicus (rat): 24664
Entry
24664             CDS       T01003                                 

Gene name
Pomc, Pomc1, Pomc2, alphaMSH
Definition
(RefSeq) proopiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04920  Adipocytokine signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24664 (Pomc)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24664 (Pomc)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    24664 (Pomc)
   04915 Estrogen signaling pathway
    24664 (Pomc)
   04916 Melanogenesis
    24664 (Pomc)
   04925 Aldosterone synthesis and secretion
    24664 (Pomc)
   04927 Cortisol synthesis and secretion
    24664 (Pomc)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24664 (Pomc)
SSDB
Motif
Pfam: NPP ACTH_domain Op_neuropeptide
Other DBs
NCBI-GeneID: 24664
NCBI-ProteinID: NP_647542
RGD: 3366
Ensembl: ENSRNOG00000012686
UniProt: Q8K422
Position
6q14
AA seq 235 aa
MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACRLDLSAETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGGSAQRRAEEETAGGDGRPEPSPRE
GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGEQPDGLEHVLEP
DTEKADGPYRVEHFRWGNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
NT seq 708 nt   +upstreamnt  +downstreamnt
atgccgagattctgctacagtcgctcaggggccctgctgctggccctcctgcttcagacc
tccatagacgtgtggagctggtgcctggagagcagccagtgccaggacctcaccacggaa
agcaacctgctggcttgcatccgggcctgcagactcgacctctcggcggagacgcccgtg
tttccaggcaacggagatgaacagcccttgactgaaaatccccggaagtacgtcatgggt
cacttccgctgggaccgcttcggccccagaaacagcagcagtgctggcggctcagcgcag
aggcgtgcggaggaagagacggcggggggagatggccgtccggagccaagtccacgggag
ggcaagcgctcctactccatggagcacttccgctggggcaagccggtgggcaagaagcgg
cgccctgtgaaggtgtaccccaatgtcgccgagaacgagtcggccgaggcctttccccta
gagttcaagagggagctggaaggcgagcagcctgatggcttggagcacgtcctggagccg
gataccgagaaggccgacgggccctatcgggtggagcacttccgctggggcaacccgccc
aaggacaagcgctacggcggcttcatgacctccgagaagagccagacgcccctggtgacg
ctcttcaagaacgccatcatcaagaacgcgcacaagaagggccagtga

DBGET integrated database retrieval system