KEGG   Rattus norvegicus (rat): 24666Help
Entry
24666             CDS       T01003                                 

Gene name
Ppm1a, Pp2c1
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent, 1A
  KO
K04457  protein phosphatase 1A [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24666 (Ppm1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24666 (Ppm1a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24666 (Ppm1a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    24666 (Ppm1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_C
Motif
Other DBs
NCBI-GeneID: 24666
NCBI-ProteinID: NP_058734
RGD: 3373
Ensembl: ENSRNOG00000005916
UniProt: P20650
Position
6q24
AA seq 382 aa AA seqDB search
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAE
AVKKEAELDKYLENRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSASTDDMW
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggagcatttttagacaagccaaagatggaaaagcataatgcccagggccaggggaac
gggttgcgatacggcctaagcagcatgcaaggttggcgagttgaaatggaggatgcacat
acggctgtgatcggtttgccaagtggacttgagacatggtcattctttgctgtatatgat
gggcatgctggttctcaggttgccaaatactgctgtgagcacttgttagatcacatcacc
aataaccaggattttaaaggctctgcaggagcaccctctgtggaaaacgtaaagaacgga
atcagaacaggttttctggagattgatgaacacatgagagttatgtcagagaagaaacac
ggtgcagatagaagtgggtcaacagctgtgggtgtcttaatttctccccaacatacttat
ttcattaactgtggggactcaagaggtttactttgtagaaatagaaaagttcacttcttc
actcaagaccataaaccaagtaatcctctggaaaaagaacgaattcagaatgcagggggc
tctgtgatgattcagcgtgtcaatggctctctggctgtatcaagagctcttggggatttt
gattacaaatgtgtccatggaaaaggtcccacagagcagcttgtctcgccagagcctgaa
gtccatgatattgaaaggtctgaagaagatgaccagttcatcattcttgcatgtgatggc
atctgggacgtcatgggcaacgaagagctctgtgactttgtgagatccagacttgaagtc
actgatgaccttgagaaagtttgcaatgaagtagtcgacacctgtttgtataagggaagt
cgagacaacatgagtgtgattttgatctgctttccaaacgcgcctaaagtctcagcagag
gcggtgaagaaggaggcagagctggacaagtacctggagaacagagtagaagaaatcata
aagaagcagggggaaggcgtccctgacttagtccatgtgatgcgcacgttagccagtgag
aacatccccagcctcccaccagggggtgaactggcaagcaagcggaatgtaattgaagcc
gtttacaatagactgaacccttacaaaaacgacgacactgattctgcgtcaactgatgat
atgtggtaa

DBGET integrated database retrieval system