KEGG   Rattus norvegicus (rat): 24673
Entry
24673             CDS       T01003                                 
Symbol
Ppp2cb
Name
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04071  Sphingolipid signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04660  T cell receptor signaling pathway
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno05142  Chagas disease
rno05160  Hepatitis C
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    24673 (Ppp2cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    24673 (Ppp2cb)
   04390 Hippo signaling pathway
    24673 (Ppp2cb)
   04071 Sphingolipid signaling pathway
    24673 (Ppp2cb)
   04151 PI3K-Akt signaling pathway
    24673 (Ppp2cb)
   04152 AMPK signaling pathway
    24673 (Ppp2cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24673 (Ppp2cb)
   04136 Autophagy - other
    24673 (Ppp2cb)
  09143 Cell growth and death
   04110 Cell cycle
    24673 (Ppp2cb)
   04114 Oocyte meiosis
    24673 (Ppp2cb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24673 (Ppp2cb)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    24673 (Ppp2cb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24673 (Ppp2cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    24673 (Ppp2cb)
   04730 Long-term depression
    24673 (Ppp2cb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    24673 (Ppp2cb)
   05165 Human papillomavirus infection
    24673 (Ppp2cb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24673 (Ppp2cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24673 (Ppp2cb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    24673 (Ppp2cb)
   04131 Membrane trafficking [BR:rno04131]
    24673 (Ppp2cb)
   03036 Chromosome and associated proteins [BR:rno03036]
    24673 (Ppp2cb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24673 (Ppp2cb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24673 (Ppp2cb)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     24673 (Ppp2cb)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     24673 (Ppp2cb)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    24673 (Ppp2cb)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     24673 (Ppp2cb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24673 (Ppp2cb)
SSDB
Motif
Pfam: Metallophos STPPase_N zf-TAZ
Other DBs
NCBI-GeneID: 24673
NCBI-ProteinID: NP_058736
RGD: 3381
Ensembl: ENSRNOG00000015182
UniProt: P62716
Position
16:complement(65261178..65282658)
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtggagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaaca
aaagaatcaaatgtacaagaggttcgctgtcctgttaccgtctgtggagatgtgcatggc
caattccatgaccttatggaactcttcagaattggtggaaaatcaccagacaccaactat
ctattcatgggtgactatgtagacagaggatattattctgtggagaccgtgactcttctt
gtagcattaaaggtgcgctatccagagcgtatcacaatattgcgaggaaatcatgaaagc
cggcagatcacacaagtatatggcttttatgatgaatgcctacgaaagtatgggaacgcc
aacgtgtggaaatactttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccacggtggcctctctccatccatagatacactggatcacata
agagccctggatcgcttacaggaagttccacatgagggcccaatgtgtgatctcttatgg
tcagatccagatgaccgtggtggctggggcatttctccacgtggtgctggctacacattt
ggacaagacatttctgaaacatttaaccatgccaacggcctcacactggtgtcccgtgct
caccagcttgtaatggaaggatataattggtgccatgatcggaatgtggtcaccattttt
agtgcacccaattactgctaccgctgtgggaaccaggctgctatcatggaattagacgac
actttaaaatactcttttcttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcaccccagactacttcctataa

DBGET integrated database retrieval system