KEGG   Rattus norvegicus (rat): 24675
Entry
24675             CDS       T01003                                 

Gene name
Ppp3cb, Calna2
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24675 (Ppp3cb)
   04310 Wnt signaling pathway
    24675 (Ppp3cb)
   04370 VEGF signaling pathway
    24675 (Ppp3cb)
   04020 Calcium signaling pathway
    24675 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    24675 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24675 (Ppp3cb)
   04218 Cellular senescence
    24675 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24675 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    24675 (Ppp3cb)
   04660 T cell receptor signaling pathway
    24675 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    24675 (Ppp3cb)
   04659 Th17 cell differentiation
    24675 (Ppp3cb)
   04662 B cell receptor signaling pathway
    24675 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24675 (Ppp3cb)
   04921 Oxytocin signaling pathway
    24675 (Ppp3cb)
   04924 Renin secretion
    24675 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    24675 (Ppp3cb)
   04728 Dopaminergic synapse
    24675 (Ppp3cb)
   04720 Long-term potentiation
    24675 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    24675 (Ppp3cb)
   04380 Osteoclast differentiation
    24675 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24675 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24675 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis
    24675 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    24675 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24675 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24675 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    24675 (Ppp3cb)
   05163 Human cytomegalovirus infection
    24675 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24675 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24675 (Ppp3cb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24675 (Ppp3cb)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     24675 (Ppp3cb)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 24675
NCBI-ProteinID: NP_058738
RGD: 3383
Ensembl: ENSRNOG00000054782
UniProt: P20651
Position
15p16
AA seq 525 aa
MAAPEPARAAPPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGSSPPHRICSF
EEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENHGTGNHSAQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggccgcgccgccccctcccccgcccccgccgcccccc
ctcggggccgaccgcgtcgtcaaagccgttccttttcccccaactcaccggttgacatct
gaagaagtgtttgatatggatgggatacccagggttgatgttctgaagaaccatctggta
aaagaaggtcgggtagatgaagaaattgcactaagaattatcaatgagggtgctgccata
cttaggcgggagaaaaccatgatagaagtagaagctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtcttg
tatttatgggtcttgaagattctatacccaagcacattattccttctgagaggcaaccat
gaatgcagacacctcactgagtattttacctttaagcaggaatgtaaaattaagtattca
gaaagggtctatgaagcttgtatggaggcttttgacagcttgccccttgctgcacttcta
aaccaacaatttctttgtgttcatggtggactttcaccagagatacacacactggatgat
attaggagattagatagatttaaagagccacctgcatttggaccaatgtgtgacttgctg
tggtctgatccttctgaagactttggaaatgaaaaatcacaagaacattttagtcataat
acggttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggtttccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtactaaagtatgagaacaatgtgatgaacatc
cgccagtttaactgttctccacatccttactggttgcccaattttatggatgtctttaca
tggtctttaccatttgttggagaaaaagtcacagagatgttggtaaatgttctcagtatt
tgctctgatgatgaactaatgacagaaggggaagaccagtttgatgtaggttcagctgca
gcccggaaagaaatcataagaaacaagatccgagcaattggcaagatggcaagagtcttc
tctgttctcagggaggagagtgaaagcgtgctgacactcaagggcctgactcccacaggg
atgttgcctagtggagtgttggctggaggacggcagaccttgcaaagtgccacagttgag
gctattgaggctgaaaaagcaatacgaggatcctctccaccacatagaatctgcagtttt
gaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagatgctgtg
cagcaagatggtttcaattccctgaacaccgcacataccactgagaaccacgggactggc
aaccatagtgcccagtga

DBGET integrated database retrieval system