KEGG   Rattus norvegicus (rat): 246756Help
Entry
246756            CDS       T01003                                 

Gene name
Tradd
Definition
(RefSeq) TNFRSF1A-associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04071  Sphingolipid signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    246756 (Tradd)
   04064 NF-kappa B signaling pathway
    246756 (Tradd)
   04668 TNF signaling pathway
    246756 (Tradd)
   04071 Sphingolipid signaling pathway
    246756 (Tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    246756 (Tradd)
   04217 Necroptosis
    246756 (Tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    246756 (Tradd)
   04657 IL-17 signaling pathway
    246756 (Tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    246756 (Tradd)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    246756 (Tradd)
  09167 Infectious diseases
   05152 Tuberculosis
    246756 (Tradd)
   05160 Hepatitis C
    246756 (Tradd)
   05163 Human cytomegalovirus infection
    246756 (Tradd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    246756 (Tradd)
   05169 Epstein-Barr virus infection
    246756 (Tradd)
   05165 Human papillomavirus infection
    246756 (Tradd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death Luteo_PO
Motif
Other DBs
NCBI-GeneID: 246756
NCBI-ProteinID: NP_001093950
RGD: 621313
Ensembl: ENSRNOG00000015179
UniProt: D3ZZC5
Position
19q11
AA seq 310 aa AA seqDB search
MAADQNGHEEWVGSAYLFLESSMDKVVLSEAYTDPKKKVAIYKALQAALSESGDSPDVLQ
ILKIHCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGS
KSLVSSPAEEKPLPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPEGGQA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgatcagaatggccatgaggagtgggtgggcagtgcatacctgtttttggag
tcttcgatggacaaagtggtcctatctgaagcctacacagatcccaagaagaaagtggca
atctacaaggctctgcaggctgcattgtcagagagtggggacagccccgacgtactgcag
atactcaagatccactgcagcgaccctcagctcatcgttcagttgcgtttctgcgggcgc
ctgctatgcggccgctttctccaagcctaccgcgagggggcgctgcgcaccgcactgcag
aggtgcatggccgcggcgcttgcccaggaagcagtgcggttgcaactggagttgcgtgct
ggtgcggagcagctggacagttggctgaccgacgaagagcgctgtttgaattacatctta
gcccagaagcccgaccggctcagggacgaagaactcgcggagctggaggatgagttctgc
aaactgacgtgtgactccactggccagggtggagccacacaggtagctccagcaggttcg
aagtccctggtttcctctccggccgaggagaagccactgccggccgccggccagactttt
ctgttccatggtcagctcatagtgaaccggccactgaatctgcaagaccagcagacattc
gcgcgctcagtgggcctcaagtggcgcagggtagggcgctcgctgcagcgtagctgtcga
gcactgagggatcctgccctcgactcgctggcctatgagtatgagcgtgatgggctatat
gagcaggccttccagctgctgcgccgtttcatacaagccgagggccgccgtgccacactg
caacgcctagtggaggcgctggaggagaacgagctcactagtctagcagaagatctgcta
ggccaggcggagccggaaggcggccaggcttaa

DBGET integrated database retrieval system