KEGG   Rattus norvegicus (rat): 246774Help
Entry
246774            CDS       T01003                                 

Gene name
Gimap5, IAN4, Ian4l1, Ian5, lyp
Definition
(RefSeq) GTPase, IMAP family member 5
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AIG1 MMR_HSR1 AAA_18 AAA_16 ABC_tran
Motif
Other DBs
NCBI-GeneID: 246774
NCBI-ProteinID: NP_001029085
RGD: 628871
Ensembl: ENSRNOG00000008416
UniProt: Q8K3L6
Position
4q24
AA seq 326 aa AA seqDB search
MEDHGFEELSTRTHDLNVRRLTKGNINFLLSTGQETYSVEDSGLLRILLVGKSGCGKSAT
GNSILRRPAFESRLRGQSVTRTSQAEMGTWEGRSFLVVDTPPIFESKIQNQDMDKDIGNC
YLMCAPGPHVLLLVTQLGRYTVEDAMAVRMVKQIFGVGVMRYMIVLFTHKEDLADESLEE
FVTHTGNLDLHRLVQECGRRYCAFNNKASGEEQQGQLAELMALVRRLEQEHEGSFHSNDL
FVYTQVFLRGGYSEHQEPYKFYLTKVRQEVEKQKRELEEQEGSWMAKMLCRVTSCLDWHI
AVSVLLIVLGLTLLITLINMYIGRWK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccatggctttgaggaactatccacaaggacccatgacctcaacgtcagaaga
ctcactaagggaaacataaactttctcttgtctacaggacaagaaacctacagtgtagaa
gactctggcctcctgaggatcctcctggtgggtaaatctggctgcggaaaaagtgccaca
gggaacagcattctccgcagaccagcgttcgagtccaggctcagaggccagtctgtgacc
aggaccagtcaggcagagatgggcacatgggagggaaggagcttcctagtggtggacacg
ccccccatcttcgagtcaaagatccagaaccaagacatggacaaggacattgggaactgc
tacctgatgtgtgccccaggaccccatgtgttgttgctggtgacccaactgggacgctac
acagtcgaagatgccatggctgtgaggatggtgaagcagatctttggggtaggggtcatg
aggtacatgattgtcctcttcacccacaaggaagacctggcagatgagtccttggaagag
tttgtgacccacacaggcaacctcgacctgcacagactggttcaggagtgtgggaggagg
tactgtgcctttaataacaaggcttctggggaggagcagcaggggcagctggcagagctc
atggccctggtgagaagactggaacaggagcatgagggctccttccacagcaatgacctc
ttcgtttatactcaggtgttccttagaggtggctacagtgaacaccaggagccatacaag
ttctacctgaccaaggtgaggcaggaggtagagaagcagaagagggagctggaggagcag
gagggcagctggatggctaaaatgctttgcagagtcacgtcctgcttggactggcacatt
gcagtgtctgttcttcttattgttcttggtctgacccttctcatcactttaattaatatg
tacattggcaggtggaaatga

DBGET integrated database retrieval system