KEGG   Rattus norvegicus (rat): 246775
Entry
246775            CDS       T01003                                 

Gene name
Tnfsf10
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04068  FoxO signaling pathway
rno04210  Apoptosis
rno04217  Necroptosis
rno04650  Natural killer cell mediated cytotoxicity
rno05132  Salmonella infection
rno05164  Influenza A
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    246775 (Tnfsf10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246775 (Tnfsf10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    246775 (Tnfsf10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    246775 (Tnfsf10)
   04217 Necroptosis
    246775 (Tnfsf10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    246775 (Tnfsf10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    246775 (Tnfsf10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    246775 (Tnfsf10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    246775 (Tnfsf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    246775 (Tnfsf10)
   04052 Cytokines and growth factors [BR:rno04052]
    246775 (Tnfsf10)
   04090 CD molecules [BR:rno04090]
    246775 (Tnfsf10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   246775 (Tnfsf10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   246775 (Tnfsf10)
CD molecules [BR:rno04090]
 Proteins
  246775 (Tnfsf10)
SSDB
Motif
Pfam: TNF CFTR_R
Other DBs
NCBI-GeneID: 246775
NCBI-ProteinID: NP_663714
RGD: 628734
Ensembl: ENSRNOG00000013269
UniProt: E9PU84
Position
2
AA seq 291 aa
MPSTGNLKGPSFSQHFTMTVICIVLLQVLLQALTVAVTYMYFNNEVKQLQDNYSKIGLAC
FSKEDGDFWDSTDEGILNRPCLQVKRQLYQLIEEVTLRTFEKTISTVPEKQLSTPPLPRG
RRPQRVAAHITGITRRSNLALIPISKDGKTLGQKIETWESSRRGHSFLNHVHLRNGELVI
QEEGLYYIYSQTYYRFKEAKEASKTVSKDGGRIKQMVQYIYKYTSYPDPILLMKSARNSC
WSREAEYGLYSIYQGGLFELKENDRIFVSVTNEHLMDLDQEASFFGAFLIN
NT seq 876 nt   +upstreamnt  +downstreamnt
atgccttccaccgggaacctgaagggccccagcttcagtcagcacttcacgatgacggtg
atctgcatagtgctcctgcaggtgctcctgcaggccttgactgtggctgtgacttacatg
tacttcaacaacgaggtgaaacagctacaggacaattactccaaaatcggactagcttgc
ttctcaaaagaagatggggatttttgggactccactgacgaggggattttgaacagacct
tgcttgcaggtcaagaggcaactgtatcagctcattgaagaggtgactttgagaaccttt
gagaaaaccatctctacagttccagaaaagcagctaagcactcctcccttgcccagaggt
agaagaccccagagagtggcagctcacattaccgggatcactcggagaagcaacttagcc
ttaattccaatctccaaggatggaaagaccttgggccagaagatagaaacctgggagtcc
tctcggagagggcattcatttctcaaccatgtgcacttgagaaacggagagctggtgatc
caggaggagggcctgtattacatctactcccaaacgtactaccggttcaaggaggctaaa
gaagcttccaagacagtctcgaaggacggagggaggatcaaacagatggtgcagtacatc
tacaaatacaccagctaccccgatcccatactgctgatgaagagtgccagaaatagctgc
tggtccagagaagctgagtacggactgtactccatctatcagggggggctgttcgagctc
aaagaaaatgacaggatttttgtttccgtgacgaatgagcatttgatggacctggatcaa
gaagccagtttctttggagcctttttaattaactag

DBGET integrated database retrieval system