KEGG   Rattus norvegicus (rat): 24683Help
Entry
24683             CDS       T01003                                 

Gene name
Prl, Gha1, PRLB, PRLSD1, Prl1a1, Prol, RATPRLSD1, RNPROL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  Jak-STAT signaling pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    24683 (Prl)
   04151 PI3K-Akt signaling pathway
    24683 (Prl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24683 (Prl)
   04060 Cytokine-cytokine receptor interaction
    24683 (Prl)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    24683 (Prl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24683 (Prl)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   24683 (Prl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_1 KIAA1430 Lipl32
Motif
Other DBs
NCBI-GeneID: 24683
NCBI-ProteinID: NP_036761
RGD: 3403
Ensembl: ENSRNOG00000017374
UniProt: P01237 B5DEM6
Position
17p12
AA seq 226 aa AA seqDB search
MNSQVSARKAGTLLLLMMSNLLFCQNVQTLPVCSGGDCQTPLPELFDRVVMLSHYIHTLY
TDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWND
PLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQL
PSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccaagtgtcagcccggaaagcagggacactcctcctgctgatgatgtcaaac
cttctgttctgccaaaatgtgcagaccctgccagtctgttctggtggcgactgccagaca
cctctcccggagctgtttgaccgtgtggtcatgctttctcactacatccataccctgtat
acagatatgtttattgaatttgataaacagtatgtccaagatcgtgagtttattgccaag
gccatcaatgactgccccacttcttccctagctactcctgaagacaaggaacaagcccag
aaagtccctccggaagttcttttgaacctgatcctcagtttggtgcactcctggaatgac
cctctgtttcaactaataactggactaggtggaatccatgaagctcctgatgctatcata
tcaagagccaaagagattgaggaacaaaacaagcggcttcttgaagggattgaaaagata
attagccaggcctatcctgaagccaaaggaaatgagatctacttggtttggtcacaactc
ccatccctgcaaggagttgatgaagaatccaaagacttggctttttataacaacattcgg
tgcctgcgcagggattcccacaaggttgacaattatctcaagttcctgaggtgccaaatt
gtccataaaaacaactgctaa

DBGET integrated database retrieval system