KEGG   Rattus norvegicus (rat): 24686
Entry
24686             CDS       T01003                                 

Gene name
Prnp
Definition
(RefSeq) major prion protein precursor
  KO
K05634  prion protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    24686 (Prnp)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    24686 (Prnp)
   05022 Pathways of neurodegeneration - multiple diseases
    24686 (Prnp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24686 (Prnp)
   04090 CD molecules [BR:rno04090]
    24686 (Prnp)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24686 (Prnp)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24686 (Prnp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24686 (Prnp)
CD molecules [BR:rno04090]
 Proteins
  24686 (Prnp)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   24686 (Prnp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  24686 (Prnp)
SSDB
Motif
Pfam: Prion Prion_bPrPp Gly-zipper_Omp UNC80
Other DBs
NCBI-GeneID: 24686
NCBI-ProteinID: NP_036763
RGD: 3410
Ensembl: ENSRNOG00000021259
UniProt: P13852
Position
3
AA seq 254 aa
MANLGYWLLALFVTTCTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQWNKPSKPKTNLKHVAGAAAAGA
VVGGLGGYMLGSAMSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSAVLFSSPP
VILLISFLIFLIVG
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcgaaccttggctactggctgctggccctctttgtgactacatgtactgatgttggc
ctctgcaaaaagcggccaaagcctggagggtggaacactggtggaagccggtaccctggg
cagggaagccctggaggcaaccgttacccacctcagagtggtggtacctgggggcagccc
catggtggtggctggggacaacctcatggtggtggctggggacaacctcatggtggtggc
tggggtcagccccatggcgggggctggagtcaaggagggggtacccataatcagtggaac
aagcccagcaagccaaaaaccaacctcaagcatgtggcaggggctgccgcagctggggca
gtagtggggggccttggtggctacatgttggggagtgccatgagcaggcccatgctccat
tttggcaacgactgggaggaccgctactaccgagaaaacatgtaccgttaccctaaccaa
gtgtactacaggccggtggatcagtacagcaaccagaacaacttcgtgcacgactgtgtc
aatatcaccatcaagcagcatacagtcaccaccaccaccaagggggagaacttcacggag
accgacgtgaagatgatggagcgtgtggtggagcagatgtgcgtcacccagtatcagaag
gagtcccaggcctattacgacgggagaagatctagcgccgtgcttttctcctcccctcct
gtgatcctcctcatctccttcctcatcttcctgatcgtgggatga

DBGET integrated database retrieval system