KEGG   Rattus norvegicus (rat): 24689Help
Entry
24689             CDS       T01003                                 

Gene name
Prps2
Definition
(RefSeq) phosphoribosyl pyrophosphate synthetase 2
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00030  Pentose phosphate pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    24689 (Prps2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24689 (Prps2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     24689 (Prps2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 24689
NCBI-ProteinID: NP_036766
RGD: 3415
Ensembl: ENSRNOG00000004160
UniProt: P09330
Position
Xq13
AA seq 318 aa AA seqDB search
MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGC
GEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAG
ADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENITEWRNCIIVSPDAGGAKRVTS
IADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAG
ATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAI
RRTHNGESVSYLFSHVPL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacatcgtgctcttcagcggcagctctcaccaggacctgtcgcagcgcgtggcc
gatcgcctgggcctggagctgggcaaggtggtcaccaagaagtttagcaaccaggagacc
agtgtcgagattggtgaaagtgtgcgaggggaagatgtctatatcatccagagcggctgt
ggggaaattaatgacaacttgatggagctactcatcatgatcaacgcgtgcaagattgca
tcctcatccagggtaacagctgtgataccctgcttcccctacgcccggcaagataaaaag
gacaagagtcgtgctccaatttctgctaagcttgtggccaatatgttgtcagttgctggg
gctgatcacatcattaccatggacctgcatgcctctcagatccagggcttctttgatatt
cctgtggataatttatatgcagaacctgcagttcttcagtggattcgggagaacatcact
gaatggagaaactgtattattgtttctccagatgctggaggagccaaaagggttacgtca
attgcagacagactgaatgtggaatttgctttgattcacaaagagagaaagaaagcaaat
gaagtggaccggatggttcttgtgggcgatgtgaaggaccgtgtggctatcctggtggac
gacatggctgacacatgtggtaccatctgtcatgctgcagataagttactctcagctggt
gccaccaaagtttatgctattcttacccatggaatcttctctgggccagctatttccaga
ataaataatgctgcctttgaagcagttgttgtcaccaataccattccacaagaggacaaa
atgaaacactgttccaaaattcaggtgatcgacatttcaatgattctggctgaggccatt
cgaagaacccacaatggggaatccgtgtcctatctgttcagccatgtcccgctgtag

DBGET integrated database retrieval system