KEGG   Rattus norvegicus (rat): 24695Help
Entry
24695             CDS       T01003                                 

Gene name
Pthlh, PLP
Definition
(RefSeq) parathyroid hormone-like hormone
  KO
K22608  parathyroid hormone-related hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    24695 (Pthlh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Parathyroid
Motif
Other DBs
NCBI-GeneID: 24695
NCBI-ProteinID: NP_036768
RGD: 3441
UniProt: P13085
Position
4q44
AA seq 177 aa AA seqDB search
MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRREQEKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggaggctggttcagcagtggagcgtcctggtgttcctgctcagctactccgtg
ccctcccgcgggcgctcggtggaggggcttggtcgcaggctaaaacgcgcggtgtctgag
caccagctactgcatgacaagggcaagtccatccaagacttgcgccgccgtttcttcctc
caccatctgattgcggagatccacacagctgaaatcagagctacctcggaggtgtcccct
aactccaaacctgctcccaacaccaaaaaccaccctgtgcggtttgggtcagacgacgag
ggcagatacctaactcaggaaaccaacaaggtggagacgtacaaagagcagccactcaag
acgcccgggaagaagaagaaaggcaagccggggaaacgcagagaacaggagaaaaaaaag
cgaaggactcggtctgcctggccaggcacaactgggagtggcctgcttgaggacccccag
ccccacacctccccgacctcgacctccctggagcccagctcaaggacgcattga

DBGET integrated database retrieval system