KEGG   Rattus norvegicus (rat): 24697Help
Entry
24697             CDS       T01003                                 

Gene name
Ptpn1, Ptp
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
rno04910  Insulin signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    24697 (Ptpn1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24697 (Ptpn1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    24697 (Ptpn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24697 (Ptpn1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     24697 (Ptpn1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    24697 (Ptpn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 TUDOR_5
Motif
Other DBs
NCBI-GeneID: 24697
NCBI-ProteinID: NP_036769
RGD: 61965
Ensembl: ENSRNOG00000010574
UniProt: P20417
Position
3q42
AA seq 432 aa AA seqDB search
MEMEKEFEQIDKAGNWAAIYQDIRHEASDFPCRIAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLK
CAQYWPQKEEKEMVFDDTNLKLTLISEDVKSYYTVRQLELENLATQEAREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHVPPPPRPPKRTLEPHNGKCKELFSNHQWVSEESCEDEDILAREESRAPSIAVHSM
SSMSQDTEVRKRMVGGGLQSAQASVPTEEELSPTEEEQKAHRPVHWKPFLVNVCMATALA
TGAYLCYRVCFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggagaaggaattcgagcagatcgataaggctgggaactgggcggctatttac
caggatattcgacatgaagccagtgacttcccatgcagaatagcgaaacttcctaagaac
aaaaaccggaacaggtaccgagatgtcagcccttttgaccacagtcggattaaattgcat
caggaagataatgactatatcaatgccagcttgataaaaatggaggaagcccagaggagc
tatatcctcacccagggccctttaccaaacacgtgcgggcacttctgggagatggtgtgg
gagcagaagagcaggggcgtggtcatgctcaaccgcatcatggagaaaggctcgttaaaa
tgtgcccagtattggccacagaaagaagaaaaagagatggtcttcgatgacaccaatttg
aagctgacactgatctctgaagatgtcaagtcatattacacagtacggcagttggagttg
gagaacctggctacccaggaggctcgagagatcctgcatttccactacaccacctggcct
gactttggagtccctgagtcacctgcctctttcctcaatttcctattcaaagtccgagag
tcaggctcactcagcccagagcacggccccattgtggtccactgcagtgctggcattggc
aggtcagggaccttctgcctggctgacacctgcctcttactgatggacaagaggaaagac
ccgtcctctgtggacatcaagaaagtgctgttggagatgcgcaggttccgcatggggctc
atccagacggccgaccaactgcgcttctcctacctggctgtgatcgagggtgcaaagttc
atcatgggcgactcgtcagtgcaggatcagtggaaggagctttcccatgaagacctggag
cctccccctgagcacgtgcccccacctccccggccacccaaacgcacattggagcctcac
aatggcaagtgcaaggagctcttctccaaccaccagtgggtgagcgaggagagctgtgag
gatgaggacatcctggccagagaggaaagcagagccccctcaattgctgtgcacagcatg
agcagtatgagtcaagacactgaagttaggaaacggatggtgggtggaggtcttcaaagt
gctcaggcatctgtccccactgaggaagagctgtccccaaccgaggaggaacaaaaggca
cacaggccagttcactggaagcccttcctggtcaacgtgtgcatggccacggccctggcg
actggcgcgtacctctgttaccgggtatgttttcactga

DBGET integrated database retrieval system