KEGG   Rattus norvegicus (rat): 24701Help
Entry
24701             CDS       T01003                                 

Gene name
Pygm, Muscpho
Definition
(RefSeq) glycogen phosphorylase, muscle associated
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04217  Necroptosis
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Module
rno_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    24701 (Pygm)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24701 (Pygm)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24701 (Pygm)
   04922 Glucagon signaling pathway
    24701 (Pygm)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24701 (Pygm)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     24701 (Pygm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase TPR_22 COX_ARM
Motif
Other DBs
NCBI-GeneID: 24701
NCBI-ProteinID: NP_036770
RGD: 3461
Ensembl: ENSRNOG00000021090
UniProt: G3V8V3
Position
1q43
AA seq 842 aa AA seqDB search
MSRPLSDQDKRKQISVRGLAGVENVSDLKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERL
DWDKAWDVTVKTCAYTNHTVLPEALERWPVHLMETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEVIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQ
ENKLKFSAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHIITLYNRIKREPNRFMV
PRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEDNFFIFGMRVEDVE
RLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEE
YIKCQDKVSELYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
KI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggcctctttcagaccaggataagagaaagcaaatcagtgttcgtggcctagct
ggcgtggaaaatgtgtctgacctgaaaaagaacttcaaccgccacctacatttcaccctg
gtcaaggatcgcaatgtggccactccgagagattactatttcgcactggctcacaccgtg
cgggaccacctcgtgggacgctggatccgcacacagcagcattactacgaaaaggacccc
aagaggatctactacctgtctttggagttctacatggggaggacactgcagaacaccatg
gtgaacctggccttggagaatgcctgcgatgaggccacctaccagctgggtctggacatg
gaggagctggaggagatcgaggaggatgcagggttgggcaatggaggcctgggacgcctg
gcagcttgcttcctggactccatggctacactggggctagctgcctatggctacgggatc
cgctatgagtttgggatttttaatcagaagatctgtgggggctggcagatggaagaagct
gatgactggcttcgctatggcaacccctgggagaaggcccgcccagagttcacgctgcct
gtgcacttctacggtcgagtggagcacaccagtcagggtgccaagtgggtggacacacag
gtagtgttggctatgccctatgacactcctgtgcctggctatcgaaacaacgttgtcaac
accatgcgcctctggtcggccaaggcacctaatgacttcaacctcaaggacttcaacgtt
ggcggctacatccaggccgtgctggaccgaaacctggctgagaacatctcacgtgttttg
taccccaatgataacttctttgaagggaaggaattgcggctgaagcaggagtactttgtg
gtggccgccaccctccaggacatcattcgccgtttcaagtcctccaagtttggctgccgt
gatcctgtgcgcacaaactttgatgctttccctgataaggtggccatccagctcaacgac
acccacccttctttggccatccctgaactgatgaggattctggtggacctggaacgactg
gactgggacaaggcctgggatgtgacagtgaagacctgtgcctacaccaaccacacagtg
ctgcctgaagccctggagcgctggccagtgcacctcatggagacactgcttccccgccat
ctgcagatcatttatgagatcaaccagcgtttccttaatcgggtggcggccgcattccct
ggggacgtagataggctgcggcgcatgtcactcgtggaggaaggagcggtgaaacgcatc
aacatggcacacttgtgcattgctggttcccacgcagtcaacggtgtggctcgcatccat
tcggagatcctcaagaaaaccatcttcaaggacttttatgagctggagcctcacaagttc
cagaacaagaccaatggcatcacccctcggcgctggttggttctgtgtaaccctgggctg
gcagaggtcattgctgagcgcatcggtgaggagtacatctcggatctggaccagctacgc
aagctgctctcctatgtggatgatgaagcctttatccgtgatgtggccaaagtgaaacag
gaaaacaagttgaaattctctgcgtacctggagagggaatacaaagtccacatcaacccc
aactccctcttcgacgtccaggtgaagaggattcatgagtataaacgccagcttctcaat
tgccttcacatcatcaccttgtataaccgcatcaaaagggagcccaataggttcatggtg
ccaaggactatcatgattggaggcaaggctgcacccgggtaccacatggctaagatgatc
atcaagcttatcaccgccattggggatgtggtcaaccacgaccctgcggtgggagaccgc
ctccgagtgatcttcctggagaactaccgagtctcactggctgagaaagttattcccgct
gctgacctctcagagcagatctccaccgcgggcactgaggcctcaggcactggcaacatg
aagttcatgctcaacggggctctgaccatcggcaccatggatggtgccaacgtggagatg
gcagaggaggctggggaagataacttcttcatcttcggcatgcgggtggaggacgtggaa
aggctggaccagagagggtacaatgcccaggaatactacgaccggattcctgagcttcgg
cagatcatcgaacagttaagcagtggcttcttctcccctaaacagcctgacctgttcaag
gacatcgtcaacatgctcatgcaccatgaccggtttaaagtctttgcagattatgaggaa
tacattaaatgccaggacaaagtcagtgagttgtacaagaacccaagagagtggacacgg
atggtgatcaggaacatagccacctctggcaagttttccagtgaccgtaccattgcccag
tatgcccgggagatctggggtgttgaaccttctcgtcagcgcctgccagccccagatgag
aagatctga

DBGET integrated database retrieval system