KEGG   Rattus norvegicus (rat): 24703
Entry
24703             CDS       T01003                                 

Gene name
Raf1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno04270  Vascular smooth muscle contraction
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05034  Alcoholism
rno05132  Salmonella infection
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24703 (Raf1)
   04012 ErbB signaling pathway
    24703 (Raf1)
   04014 Ras signaling pathway
    24703 (Raf1)
   04015 Rap1 signaling pathway
    24703 (Raf1)
   04370 VEGF signaling pathway
    24703 (Raf1)
   04371 Apelin signaling pathway
    24703 (Raf1)
   04630 JAK-STAT signaling pathway
    24703 (Raf1)
   04068 FoxO signaling pathway
    24703 (Raf1)
   04072 Phospholipase D signaling pathway
    24703 (Raf1)
   04071 Sphingolipid signaling pathway
    24703 (Raf1)
   04024 cAMP signaling pathway
    24703 (Raf1)
   04022 cGMP-PKG signaling pathway
    24703 (Raf1)
   04151 PI3K-Akt signaling pathway
    24703 (Raf1)
   04150 mTOR signaling pathway
    24703 (Raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24703 (Raf1)
  09143 Cell growth and death
   04210 Apoptosis
    24703 (Raf1)
   04218 Cellular senescence
    24703 (Raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24703 (Raf1)
   04540 Gap junction
    24703 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    24703 (Raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24703 (Raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24703 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    24703 (Raf1)
   04660 T cell receptor signaling pathway
    24703 (Raf1)
   04662 B cell receptor signaling pathway
    24703 (Raf1)
   04664 Fc epsilon RI signaling pathway
    24703 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    24703 (Raf1)
   04062 Chemokine signaling pathway
    24703 (Raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    24703 (Raf1)
   04929 GnRH secretion
    24703 (Raf1)
   04912 GnRH signaling pathway
    24703 (Raf1)
   04915 Estrogen signaling pathway
    24703 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    24703 (Raf1)
   04917 Prolactin signaling pathway
    24703 (Raf1)
   04921 Oxytocin signaling pathway
    24703 (Raf1)
   04926 Relaxin signaling pathway
    24703 (Raf1)
   04935 Growth hormone synthesis, secretion and action
    24703 (Raf1)
   04919 Thyroid hormone signaling pathway
    24703 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    24703 (Raf1)
   04916 Melanogenesis
    24703 (Raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24703 (Raf1)
  09156 Nervous system
   04726 Serotonergic synapse
    24703 (Raf1)
   04720 Long-term potentiation
    24703 (Raf1)
   04730 Long-term depression
    24703 (Raf1)
   04722 Neurotrophin signaling pathway
    24703 (Raf1)
  09158 Development and regeneration
   04360 Axon guidance
    24703 (Raf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24703 (Raf1)
   05206 MicroRNAs in cancer
    24703 (Raf1)
   05205 Proteoglycans in cancer
    24703 (Raf1)
   05230 Central carbon metabolism in cancer
    24703 (Raf1)
   05231 Choline metabolism in cancer
    24703 (Raf1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24703 (Raf1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24703 (Raf1)
   05212 Pancreatic cancer
    24703 (Raf1)
   05225 Hepatocellular carcinoma
    24703 (Raf1)
   05226 Gastric cancer
    24703 (Raf1)
   05214 Glioma
    24703 (Raf1)
   05221 Acute myeloid leukemia
    24703 (Raf1)
   05220 Chronic myeloid leukemia
    24703 (Raf1)
   05218 Melanoma
    24703 (Raf1)
   05211 Renal cell carcinoma
    24703 (Raf1)
   05219 Bladder cancer
    24703 (Raf1)
   05215 Prostate cancer
    24703 (Raf1)
   05213 Endometrial cancer
    24703 (Raf1)
   05224 Breast cancer
    24703 (Raf1)
   05223 Non-small cell lung cancer
    24703 (Raf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24703 (Raf1)
  09165 Substance dependence
   05034 Alcoholism
    24703 (Raf1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24703 (Raf1)
   05152 Tuberculosis
    24703 (Raf1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24703 (Raf1)
   05164 Influenza A
    24703 (Raf1)
   05161 Hepatitis B
    24703 (Raf1)
   05160 Hepatitis C
    24703 (Raf1)
   05163 Human cytomegalovirus infection
    24703 (Raf1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24703 (Raf1)
   05165 Human papillomavirus infection
    24703 (Raf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24703 (Raf1)
   01522 Endocrine resistance
    24703 (Raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24703 (Raf1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     24703 (Raf1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   24703 (Raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 24703
NCBI-ProteinID: NP_036771
RGD: 3531
Ensembl: ENSRNOG00000010153
UniProt: P11345
Structure
PDB: 
1RRB

Position
4q42
AA seq 648 aa
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTASDSGVPAPPSFTMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggtttcggactcaaagatgct
gtgtttgatggctccagttgcatctcccctacaattgttcagcagtttggctatcagcgt
cgggcctctgatgatggcaaactcacggattcttctaagacaagcaatactatccgggtt
ttcttgccgaataagcaaaggactgtggtcaatgtgcggaatgggatgagcttgcacgac
tgccttatgaaagctctgaaggttagaggcctgcagccagagtgctgtgcagtgttcaga
cttcttcaggagcacaaaggtaagaaagcacgcttagattggaacaccgacgccgcctct
ctgattggagaagaactgcaagtggattttttggatcacgttccactcacaactcacaac
tttgctcggaaaacgttcctgaagcttgcattctgtgacatctgtcaaaagttcctgcta
aatggatttcgatgtcagacttgtggctacaagtttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttgctgtttccaaattccact
gcaagtgacagtggagtcccagcaccaccctctttcacaatgcgtcggatgcgagaatct
gtttcccggatgcctgctagttcccagcacagatactccacaccccatgccttcactttc
aacacctccagcccttcctctgaaggttccctgtcccagaggcagaggtcaacgtccact
cccaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccctgtccagcagccccaacaacctg
agcccaacaggctggtcacagcccaaaacccctgtgccagcacaaagagagagggcgcca
ggatctgggacccaggaaaaaaacaaaattaggcctcgtgggcagagagattcaagttat
tactgggaaatagaagccagtgaggtgatgctgtctactcggattggctcgggctccttt
ggcactgtgtacaagggcaagtggcatggagatgttgcagtaaagatcctaaaggtggtt
gacccaactccagagcaacttcaggccttcaggaacgaggtggctgttttgcgcaaaaca
cggcatgttaatatcctgctgttcatggggtacatgacaaaggacaacctggcgattgtg
acccagtggtgtgaaggcagcagtctctacaaacacctgcatgtccaggagaccaaattc
cagatgttccagctaattgacattgcccggcagacagctcagggaatggactatttacat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctc
acggtgaaaatcggagattttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggttgaacagcccactggctctgtgctgtggatggccccagaagtaatccgaatgcag
gataacaacccgttcagcttccagtccgatgtctactcctatggcattgtgctgtatgag
ctgatgactggggagcttccctactcccacatcaacaaccgagaccagatcatcttcatg
gtgggccgtgggtacgcctccccagatcttagcaggctctacaagaactgccccaaggca
atgaagaggttggtggctgactgtgtgaagaaagtcaaagaagaaaggcctttgtttcct
cagatcctgtcttccattgagctgcttcagcactctctgccgaaaatcaacaggagcgcc
tctgagccttccctgcatcgggcagctcacactgaggacatcaatgcttgtacgctgacc
acatccccaaggctaccagtcttctag

DBGET integrated database retrieval system