KEGG   Rattus norvegicus (rat): 24705Help
Entry
24705             CDS       T01003                                 

Gene name
Rara
Definition
(RefSeq) retinoic acid receptor, alpha
  KO
K08527  retinoic acid receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04915  Estrogen signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    24705 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24705 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24705 (Rara)
   05202 Transcriptional misregulation in cancer
    24705 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24705 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24705 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24705 (Rara)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    24705 (Rara)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   24705 (Rara)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 24705
NCBI-ProteinID: NP_113716
RGD: 3534
Ensembl: ENSRNOG00000009972
UniProt: Q499N1
Position
10q31
AA seq 459 aa AA seqDB search
MYESVEVGGLAPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaagtgtagaagtcggggggcttgcccccgcccctaaccccttcctagtggtg
gacttttataaccagaaccgggcctgtttgctccaggagaaggggctccctgccccgggt
ccctactccaccccactccggactccgctttggaatggctcaaaccactccatcgagacc
cagagcagcagttcggaagagatagtgcccagccctccctcaccaccacccctgcctcga
atctacaagccttgctttgtttgtcaagacaagtcatccggctaccactatggggttagc
gcctgtgagggctgtaagggcttcttccgacgcagtatccaaaagaacatggtgtatacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaaatgcttcgaagtgggcatgtccaaggagtcggtgcgaaacgaccgaaac
aaaaagaagaaagaaacacccaagcccgagtgctcagagagctacacgctgacaccggag
gtgggggaactcatcgagaaggtgcgcaaagcacaccaggagaccttcccggccctctgc
cagctgggcaagtacactacgaacaacagctcagaacaacgtgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgtatcattaagactgtggagttcgcc
aagcagcttcccggcttcaccaccctcaccattgccgaccagattacccttctcaaggct
gcctgcctggacatcctgattctgcgaatctgcacgcggtacacacctgagcaagacaca
atgaccttctcagatggactgaccctgaaccggactcagatgcacaacgctggctttggc
cccctcaccgacttggtctttgccttcgccaaccagctgctgcccctggagatggacgat
gctgagaccggactgctcagtgccatctgcctcatctgtggagaccgacaggacctggag
cagccagacaaggtggacatgctgcaggagccgctgttggaagcactgaaagtctatgtc
cggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaagatcacggac
cttcggagtatcagcgccaagggagctgaacgggtgatcacattgaagatggagatccct
ggttccatgccaccacttatccaggaaatgttggagaactctgagggcttggacactcta
agcggacagtcggggggcggaacacgagatgggggtggcctggcccctcctccgggtagc
tgtagccccagcctcagtcccagctcccacagaagcagcccagccactcaatccccatga

DBGET integrated database retrieval system