KEGG   Rattus norvegicus (rat): 24705
Entry
24705             CDS       T01003                                 

Gene name
Rara
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04915  Estrogen signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    24705 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24705 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24705 (Rara)
   05202 Transcriptional misregulation in cancer
    24705 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24705 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24705 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24705 (Rara)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    24705 (Rara)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   24705 (Rara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 24705
NCBI-ProteinID: NP_113716
RGD: 3534
Ensembl: ENSRNOG00000009972
UniProt: Q499N1
Position
10
AA seq 459 aa
MYESVEVGGLAPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtacgaaagtgtagaagtcggggggcttgcccccgcccctaaccccttcctagtggtg
gacttttataaccagaaccgggcctgtttgctccaggagaaggggctccctgccccgggt
ccctactccaccccactccggactccgctttggaatggctcaaaccactccatcgagacc
cagagcagcagttcggaagagatagtgcccagccctccctcaccaccacccctgcctcga
atctacaagccttgctttgtttgtcaagacaagtcatccggctaccactatggggttagc
gcctgtgagggctgtaagggcttcttccgacgcagtatccaaaagaacatggtgtatacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaaatgcttcgaagtgggcatgtccaaggagtcggtgcgaaacgaccgaaac
aaaaagaagaaagaaacacccaagcccgagtgctcagagagctacacgctgacaccggag
gtgggggaactcatcgagaaggtgcgcaaagcacaccaggagaccttcccggccctctgc
cagctgggcaagtacactacgaacaacagctcagaacaacgtgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgtatcattaagactgtggagttcgcc
aagcagcttcccggcttcaccaccctcaccattgccgaccagattacccttctcaaggct
gcctgcctggacatcctgattctgcgaatctgcacgcggtacacacctgagcaagacaca
atgaccttctcagatggactgaccctgaaccggactcagatgcacaacgctggctttggc
cccctcaccgacttggtctttgccttcgccaaccagctgctgcccctggagatggacgat
gctgagaccggactgctcagtgccatctgcctcatctgtggagaccgacaggacctggag
cagccagacaaggtggacatgctgcaggagccgctgttggaagcactgaaagtctatgtc
cggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaagatcacggac
cttcggagtatcagcgccaagggagctgaacgggtgatcacattgaagatggagatccct
ggttccatgccaccacttatccaggaaatgttggagaactctgagggcttggacactcta
agcggacagtcggggggcggaacacgagatgggggtggcctggcccctcctccgggtagc
tgtagccccagcctcagtcccagctcccacagaagcagcccagccactcaatccccatga

KEGG   Rattus norvegicus (rat): 315713
Entry
315713            CDS       T01003                                 

Gene name
Pml
Definition
(RefSeq) protein PML isoform X1
  KO
K10054  probable transcription factor PML
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    315713 (Pml)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    315713 (Pml)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    315713 (Pml)
   05202 Transcriptional misregulation in cancer
    315713 (Pml)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    315713 (Pml)
  09172 Infectious disease: viral
   05164 Influenza A
    315713 (Pml)
   05168 Herpes simplex virus 1 infection
    315713 (Pml)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    315713 (Pml)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    315713 (Pml)
SSDB
Motif
Pfam: DUF3583 zf-B_box BMFP Prok-RING_4 Imm71 DUF3276 zf-RING_5 DUF4404
Other DBs
NCBI-GeneID: 315713
NCBI-ProteinID: XP_038938327
RGD: 1562602
Ensembl: ENSRNOG00000008400
Position
8
AA seq 925 aa
MPPPEEPSEDHEHSQSPAEQAIKEEFQFLRCPGCQTQAKCPKLLPCLHTLCSGCLEAPGL
QCPICQAPGSANANAEALDNVFFESLQRRLAVFRQIVDAQAACTRCKELADFWCFECEQL
MCGKCFDAHQWYLKHEARPLAELRDNSVREFLDSTRKSNIFCSNTNHRTPAQTNVIMQSP
FILEEMTDPHSTIPPQRSACLLPTNSKPLQVYFIYCRGCAKPLCCECALLDRNHSHLQCE
IGKEIQQLHEELGTMTQALEEQGRTFDSAHAQMHSAIGQLDDARSDTEKQIRARVRQVIE
HVQAQERELLEAVNVRYQRDYQEIAGQLGHLEAVLQRIRTGGALVKRMKLYASEQEVLDM
HGFLRKALCRLRQEEPQNHKVQLRTSGFEEFKLCLQDLVSFITQRTDVAVAGRASPEAAS
THPEAASAQPEAASTHPEAASAQPEAASAHPESASTPGNSTDLEQPKEVQRAQAQAMELS
KTQPVAMVKSVPGAHPVPVYAFSMQGPTYREEASQTVSPMKRKCCHIDCCRKIIKMESTD
ENEDRLSTSSPEQPRPSTSKAISPPHPDGTSSTESTIPEKETPLPNNNHVASDAGETEER
IVVISSSEDSDAENLPSHELDDSSSESSSIQLEGPNSLKALDESLAEPHLEDRTLVFFDL
KIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLESGLQHFLSFLNSMHRPLLAC
PRLWGPGLPIFFQALNDINKLWEFQDAISGFLAVLPLIQERIPSASSFKLRNLAKTYLAR
NMSERSALAAVLAMRDLCCLLEVSPGLQLAQHIYSFSSLQCFASLQPLIQAQVLPQPEAR
LLALHNVSFLELLTAYRSNRQEGLKKYVHYLSLQTTPSSASTQIAQFLQALSAYMDGQLE
GHIPAGAEGTALSLSGRAENKGCLA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgcctcccccagaggaaccctccgaagaccatgaacacagccaaagccccgcggagcaa
gccataaaggaggaatttcagtttctgcgctgcccgggctgccagacccaagccaagtgc
cccaaactgctgccttgcctgcacacgctatgctccggatgcctggaggcgcccggcctg
caatgcccgatctgccaggcaccggggtcggccaatgctaatgcggaggccctggataac
gtgttcttcgagagcctgcagcggcgcctggcggtgttccggcagattgtggatgcgcag
gctgcgtgcactcgctgcaaagagttggctgacttctggtgtttcgagtgtgaacagctc
atgtgtggcaagtgctttgatgcacaccagtggtacctcaaacacgaggcccggcccctg
gccgagctccgcgacaactcagtgcgcgaattcctcgacagtactcgcaagtccaacatc
ttctgctccaataccaaccaccgcactcctgcgcagactaacgtgataatgcagtccccc
ttcatactagaggagatgactgatccccactccacaataccaccacagagaagtgcttgc
cttcttcctacgaactctaagccacttcaagtttacttcatctactgccgaggctgcgcc
aagcctctgtgttgtgaatgcgcgcttctggaccgcaaccacagccatctccagtgtgaa
attggtaaggagatccagcagctgcatgaggagctgggcaccatgacgcaggctctggag
gagcagggcagaaccttcgacagtgcccatgcacagatgcactcagccataggccagttg
gatgacgcacgctcagacactgagaagcagatccgcgcacgcgtgcgccaggtgatagaa
cacgtgcaggctcaggagcgcgagttgctcgaggcggtgaatgtgcgctaccagcgcgac
taccaggaaatagctggccagctgggccacctggaagctgtgctgcagcgcatccgcact
ggtggggcgctggtcaagaggatgaagctctacgcctccgaacaggaggtgctggatatg
catggctttctgcgcaaggcactctgtcgcttgcgccaggaggagcctcagaatcacaaa
gtccagctgcgcaccagcggcttcgaggagttcaagttgtgcctgcaggacctcgtctcc
ttcatcacccagaggacagatgtagctgtagctgggagagccagcccagaggcagccagc
actcacccagaggcagccagcgctcagccagaggcagccagcactcacccagaggcagcc
agcgctcagccagaggcagccagcgctcacccagagtcagccagcactcctgggaactcg
actgaccttgagcagcccaaggaagtgcagagggcacaggctcaggccatggagctgtct
aagacccaacctgtggctatggtaaaatcagtacctggagcacaccctgtaccagtgtat
gccttctctatgcaaggccccacgtacagagaggaggcctctcagacagtcagccccatg
aagaggaagtgctgccacatagattgctgcagaaagattatcaagatggagtccacggat
gagaacgaggacaggttgtcgacaagctcccctgagcagcctaggcccagcacttccaag
gccatctcacctccccatccggatgggacttccagcactgagagcaccatccctgaaaaa
gagacacccctgcccaacaacaaccatgtggccagtgatgcaggggaaacagaggagcga
atcgtagtgatcagcagctcagaggactcagatgccgagaatctgccctcccacgagctg
gacgacagcagcagtgagtccagtagcatccagctggagggccccaattccctcaaggcc
ttggatgagagccttgctgaaccccacttagaagacaggaccctggttttcttcgacctc
aagattgataatgaaacccagaaaattagccaactggctgcggtgaaccgggaaagcaag
ttccgtgtgctcatccagcccgaggccttcagcgtctactctaaggccgtctccctggag
tccgggctgcagcacttcctcagcttcctcaactccatgcaccgtcccctcttggcatgt
cctaggctgtgggggcccggactccccatcttcttccaggccctgaacgacattaacaaa
ctgtgggaattccaggacgccatctcggggttcttggctgtgttgcccctcatccaggaa
cgcatacccagcgccagcagcttcaaacttaggaacctagcgaagacctacctggcgaga
aacatgagcgaacggagtgccttggctgctgtgctggccatgagagatctgtgctgcctc
cttgaggtctccccaggtctgcagctggcccagcatatctactccttcagtagcttacag
tgctttgcttccctgcagcccctaattcaggcacaggtcctgccccagcctgaggcccgc
ctgctggccctccacaatgtgagcttcctagaattgctgaccgcataccgcagcaaccgg
caagagggcttgaagaagtatgtccactatctgagcctgcagaccaccccatcatcagct
tccacccagattgcccaattcctgcaggctctgagtgcctacatggatggacagttggaa
gggcacatccctgctggggcagaaggcactgctctttctctctctggcagagctgaaaat
aagggatgcctggcctag

DBGET integrated database retrieval system