KEGG   Rattus norvegicus (rat): 24705
Entry
24705             CDS       T01003                                 

Gene name
Rara
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04915  Estrogen signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    24705 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24705 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24705 (Rara)
   05202 Transcriptional misregulation in cancer
    24705 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24705 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24705 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24705 (Rara)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    24705 (Rara)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   24705 (Rara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 24705
NCBI-ProteinID: NP_113716
RGD: 3534
Ensembl: ENSRNOG00000009972
UniProt: Q499N1
Position
10
AA seq 459 aa
MYESVEVGGLAPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtacgaaagtgtagaagtcggggggcttgcccccgcccctaaccccttcctagtggtg
gacttttataaccagaaccgggcctgtttgctccaggagaaggggctccctgccccgggt
ccctactccaccccactccggactccgctttggaatggctcaaaccactccatcgagacc
cagagcagcagttcggaagagatagtgcccagccctccctcaccaccacccctgcctcga
atctacaagccttgctttgtttgtcaagacaagtcatccggctaccactatggggttagc
gcctgtgagggctgtaagggcttcttccgacgcagtatccaaaagaacatggtgtatacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaaatgcttcgaagtgggcatgtccaaggagtcggtgcgaaacgaccgaaac
aaaaagaagaaagaaacacccaagcccgagtgctcagagagctacacgctgacaccggag
gtgggggaactcatcgagaaggtgcgcaaagcacaccaggagaccttcccggccctctgc
cagctgggcaagtacactacgaacaacagctcagaacaacgtgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgtatcattaagactgtggagttcgcc
aagcagcttcccggcttcaccaccctcaccattgccgaccagattacccttctcaaggct
gcctgcctggacatcctgattctgcgaatctgcacgcggtacacacctgagcaagacaca
atgaccttctcagatggactgaccctgaaccggactcagatgcacaacgctggctttggc
cccctcaccgacttggtctttgccttcgccaaccagctgctgcccctggagatggacgat
gctgagaccggactgctcagtgccatctgcctcatctgtggagaccgacaggacctggag
cagccagacaaggtggacatgctgcaggagccgctgttggaagcactgaaagtctatgtc
cggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaagatcacggac
cttcggagtatcagcgccaagggagctgaacgggtgatcacattgaagatggagatccct
ggttccatgccaccacttatccaggaaatgttggagaactctgagggcttggacactcta
agcggacagtcggggggcggaacacgagatgggggtggcctggcccctcctccgggtagc
tgtagccccagcctcagtcccagctcccacagaagcagcccagccactcaatccccatga

KEGG   Rattus norvegicus (rat): 353227
Entry
353227            CDS       T01003                                 

Gene name
Zbtb16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    353227 (Zbtb16)
   05202 Transcriptional misregulation in cancer
    353227 (Zbtb16)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    353227 (Zbtb16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    353227 (Zbtb16)
   04121 Ubiquitin system [BR:rno04121]
    353227 (Zbtb16)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    353227 (Zbtb16)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     353227 (Zbtb16)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-met zf-C2H2_6 zf-C2H2_jaz zf_UBZ zf-C2H2_2 Endonuclease_7
Other DBs
NCBI-GeneID: 353227
NCBI-ProteinID: NP_001013199
RGD: 727921
Ensembl: ENSRNOG00000029980
UniProt: Q5S3S9
Position
8
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGGEEEEDRKARYLKNIFISKHSGEESGYANVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGALQPPAGPEEPTLAGGGRHPGVAE
VHMEMMQVDEAPGQDSPGAAESSVSGGMGDKLEERSKEGPGTPTRGSVITSARELHYGRE
ESGEQLSPPVEAGQGPPGRQESLAPPVEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRPLGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacaaagatgggtatgatccaactgcagaaccctagccaccccacggggctg
ctgtgcaaggccaatcagatgcgactggccgggactttgtgcgatgtggtcatcatggtg
gacagtcaggagttccatgcccaccggacggtgctagcctgcaccagcaagatgtttgag
atcctcttccaccggaacagccagcactacaccctggacttcctctcgccgaaaaccttc
cagcagatcctcgagtatgcctacacagccacactgcaagccaaagcagaggacctggat
gacctgctgtacgcagctgagatcctagagatcgagtacctggaggagcagtgcctgaag
atcctggagaccatccaagcatctgatgacaatgacacagaagccaccatggccgacggt
gggggcgaagaagaagaggaccgtaaggctcgatacctcaagaacatcttcatctcgaag
cattccggcgaggagagcggctatgccaatgtggctggacagagcctccctgggcccatg
gtagaccagagcccctcggtctccacctcttttggtctctcagccatgagtcctaccaag
gcagcagtggacagtttgatgaccataggacagtcactcctgcaaggagctcttcagcca
cctgcagggcctgaggaacccacactggcagggggtgggcggcaccctggggtggctgag
gtgcatatggagatgatgcaggtagatgaagcccccggccaggacagccctggggcagct
gagtctagcgtctcaggagggatgggggacaagcttgaagagaggagcaaagaggggcct
gggacccccactagaggcagtgtcatcaccagtgctagggagctgcactatgggagagag
gagagtggtgagcagctctcaccccctgttgaagctggccagggaccccctggacgacag
gagtccctggcaccaccagtggagaagcatttgggcatctactcagtgttgcccaaccac
aaggccgatgccgtgttgagcatgccgtcttcagtgacatctggtctccatgtgcaacct
gccctggcagtctccatggacttcagcacctatgggggtctgctgcctcagggcttcatc
cagagggagctgttcagcaagctaggtgagctggccgtgggcatgaaggcggagagccgt
cctctcggggagcagtgcagtgtgtgtggggtcgaacttccggacaacgaggccgtggag
cagcacaggaagctgcacagtgggatgaagacatacggatgcgaactctgtggaaaacgg
ttcctggatagtttgcgactgagaatgcatttactggctcattcagcgggtgccaaagcc
tttgtatgtgatcagtgtggcgcccagttctcaaaggaagatgccctggagacacacaga
cagacccatactggcacggacatggctgtcttctgtctgctgtgtgggaagcgctttcag
gcacagagtgcactccagcaacacatggaggtccacgcaggcgtgcgcagctatatctgc
agcgagtgcaaccgcaccttccccagccacacggctctcaagcgccaccttcgctcacat
acaggtgaccacccatatgagtgtgagttctgtggcagctgcttccgggatgagagcaca
ctcaagagccacaagcgcatccacacaggggagaagccctatgagtgtaatggctgtggc
aagaagttcagcctcaagcaccagctggagacgcactacagggttcacacaggtgagaag
ccctttgagtgcaaactctgccaccagcgctcccgagactactcggccatgatcaagcac
ctgagaacacacaatggtgcctcaccctaccaatgcaccatctgcacggaatactgcccc
agcctctcctccatgcagaagcacatgaagggccacaagccggaggagatcccgcctgac
tggaggatagagaagacatacctctacctgtgttatgtgtga

DBGET integrated database retrieval system