KEGG   Rattus norvegicus (rat): 24708
Entry
24708             CDS       T01003                                 

Gene name
Rb1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04110  Cell cycle
rno04218  Cellular senescence
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    24708 (Rb1)
   04218 Cellular senescence
    24708 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24708 (Rb1)
   05203 Viral carcinogenesis
    24708 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    24708 (Rb1)
   05225 Hepatocellular carcinoma
    24708 (Rb1)
   05226 Gastric cancer
    24708 (Rb1)
   05214 Glioma
    24708 (Rb1)
   05220 Chronic myeloid leukemia
    24708 (Rb1)
   05218 Melanoma
    24708 (Rb1)
   05219 Bladder cancer
    24708 (Rb1)
   05215 Prostate cancer
    24708 (Rb1)
   05224 Breast cancer
    24708 (Rb1)
   05222 Small cell lung cancer
    24708 (Rb1)
   05223 Non-small cell lung cancer
    24708 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24708 (Rb1)
   05161 Hepatitis B
    24708 (Rb1)
   05160 Hepatitis C
    24708 (Rb1)
   05163 Human cytomegalovirus infection
    24708 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24708 (Rb1)
   05169 Epstein-Barr virus infection
    24708 (Rb1)
   05165 Human papillomavirus infection
    24708 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24708 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24708 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24708 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24708 (Rb1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24708 (Rb1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    24708 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 24708
NCBI-ProteinID: NP_058741
RGD: 3540
Ensembl: ENSRNOG00000016029
UniProt: P33568
Position
15
AA seq 920 aa
MPPKAPRRTAAAEPPPPPPPPPEDDPAQDSDPEELPLIRLEFEKIEEPEFIALCQKLKVP
DHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETS
VYKFFDLLKEIDTSTKVDNAVSRLLKKYNVLCALYSKLERTCGLIYLTQPSSGLSTEINS
MLVLKVSWITFLLAKGEVVQMEDDLVISFQLMLCVLDYFIKLSPPALLREPYKTAATPIN
GSPRTPRRGQNRSARIAKQLESDTRTIEVLCKEHECNVDEVKNVYFKNFIPFISSLGIVS
SNGLPELESLSKRYEEVYLKSKDLDARLFLDHDKTLQTDTIDSFETERTPRKSNPDEEAN
MVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFSNCTVNPKENILKRVKDVGHIFK
EKFASAVGQGCIDIGAQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLL
ACALEVVMATYSRSMLQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMI
KHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDHLESACSLSLPLQSNHTAADMYLS
PIRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLSLFYKKVYRLAYLRLNTLCAR
LLSDHPELEHIIWTLFQHTLENEYELMKDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAY
KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRS
PYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKI
NQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTR
TRMQKQKLNDSMEISNKEEK
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagaaccgcggccgccgagcccccgccgccgccgccgccg
cctccggaggacgaccccgcgcaggacagtgaccccgaagagctgcccctgatcaggctt
gagtttgaaaaaattgaagaacctgaatttattgcattatgtcagaagttaaaggtgccc
gatcatgtcagagagagagcttggctaacgtgggagaaagtttcatctgtggatggaatc
ctggaaggatatattcagaagaagaaggaactctggggcatctgcatcttcattgcagca
gttgacctggatgagatgccattcacttttactgagcttcagaaaagcatagaaaccagt
gtctataaattctttgacttattaaaagaaattgataccagtaccaaagttgataatgct
gtgtcaaggctattgaagaagtacaatgtgttatgtgcactctacagcaaattagaacgg
acatgtggacttatatatttgacacagcccagcagtgggttatctactgaaataaattct
atgttggtgctaaaagtttcttggatcacctttttactagctaaaggagaagtagtacag
atggaagatgatctggtgatctcatttcagttaatgttgtgtgtacttgactattttatc
aagctctcgcctcctgcgctgctcagagagccgtacaaaacagctgcaacacccattaat
ggttcacctcggacacccagaagaggtcagaacaggagtgctcggatagcaaaacaacta
gaaagtgatacaagaactattgaagttctctgtaaggagcacgagtgtaatgtagatgag
gtgaaaaatgtttatttcaaaaattttatcccttttataagttcacttggaattgtatca
tctaatggacttccagagcttgaaagtctttctaaacgctacgaagaagtttatcttaaa
agcaaagatttagatgcaagactatttttggatcatgacaaaacacttcagactgatact
atagacagttttgaaacagagagaactccacgaaaaagcaaccctgatgaagaggcaaac
atggttactccacacactccagttaggactgttatgaatactattcaacagttaatggtg
attttaaattctgcaagtgatcagccatcagaaaatctgatttcctacttcagtaattgc
acagtgaatccaaaagaaaatatcctaaaaagagtaaaggatgttggacacatctttaaa
gagaagtttgctagcgctgtggggcagggatgtattgacattggagcacagcgatataaa
cttggggttcgattgtattatcgtgtgatggaatcgatgcttaaatcagaagaagaacgt
ttgtccattcagaattttagcaaactcctaaatgacaacatctttcatatgtctttattg
gcctgtgctcttgaagttgtaatggctacatatagcaggagtatgttacagaatcttgat
tctggaacagatttgtccttcccgtggattctgaatgtacttaatttaaaagcctttgat
ttttacaaagtgattgaaagttttatcaaagtggaagccaacttgacaagagaaatgata
aaacatttagaaagatgtgagcatcgaatcatggaatcccttgcatggctttctgattca
cctttgtttgatctcataaagcagtccaaggatggggaaggacctgatcaccttgagtct
gcttgttctctcagcctccctctccagagtaaccacactgcagcagatatgtatctttct
cctataagatctccaaagaaaagaacttctactacacgtgtaaattctgcggcaaataca
gagacgcaagcagcctcagccttccatactcagaagccattgaaatctacctccctttcc
ctgttttacaaaaaagtgtaccgtctagcatatctccgactaaatacactgtgtgcgcgc
cttctgtctgatcacccagagctagaacacatcatctggactctgtttcagcatacattg
gaaaatgagtatgagctcatgaaagaccgacatttggaccagattatgatgtgttctatg
tatggcatctgcaaggtgaaaaacattgaccttaaattcaaaatcatcgtaactgcgtat
aaggatcttcctcacgctgcccaggagacctttaaacgtgttttgatcagagaagaggag
tttgattccattatagtgttctacaactcagttttcatgcagagactaaaaacaaatatt
ttacagtatgcctccaccaggcctcctaccttgtcaccaatacctcacattcctcgaagc
ccttacaagttctctagttcacccttgcggattcctggaggtaacatctatatatcaccc
ctaaagagtccttataaaatttcagaaggtctgccaacacccacaaaaatgactccaaga
tcaagaatcttggtctcaatcggtgaatcatttgggacatccgagaagttccagaaaata
aaccagatggtgtgtaacagtgacagagtgctcaaaagaagtgctgaaggcggcaatccc
cccaaacccctgaagaagctgcgctttgacatcgaaggatccgatgaagcagacgggagt
aaacatctcccagcggagtccaaattccaacagaaactggcagaaatgacttctactcga
acacgaatgcaaaagcagaaactgaatgatagcatggaaatctcaaacaaggaggaaaag
tga

KEGG   Rattus norvegicus (rat): 680111
Entry
680111            CDS       T01003                                 

Gene name
Rbl1
Definition
(RefSeq) retinoblastoma-like protein 1
  KO
K04681  retinoblastoma-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    680111 (Rbl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    680111 (Rbl1)
   04218 Cellular senescence
    680111 (Rbl1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680111 (Rbl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    680111 (Rbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    680111 (Rbl1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    680111 (Rbl1)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB Rb_C
Other DBs
NCBI-GeneID: 680111
NCBI-ProteinID: NP_001177995
RGD: 1595511
Ensembl: ENSRNOG00000006921
UniProt: D3ZS28
Position
3
AA seq 1049 aa
MFEDEPHAEGAAAVAAAREALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGVMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKFEPIFLDIFQNPYEELPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRRDLLNPSFKGLPSDFHAVNFK
AAEEPPCIIAVLCDLHDGLLVEAKGIKEHYFKPYISKLFDKKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFAADTQFGKLTSQASVDCNLQQHFE
KKRSFAPSTPLTGRRYLQEKEAVTTPVASATQSVSRLQSIVAGLKSAPSEQLLTIFESCM
RNPMGNIVKIVKGIGETFCQHYTQSTDKQPGSHIDFAVNRLKLAEILYYKILETIMVQET
RRLHGMDMSVLLEQDIFHRSLLACCLEIVLFAYSSPRTFPWIIDVLGLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWTNNSALWEALRASANKVPSCEEVIFPNNFEIG
NGGSVQGHLPMMPMSPIIHPRVKEVRTDSGSLRKDMQPLSPISVHERYSSPAAGSAKRRL
FGDDPPKETLMEKIMAEGTQLKIAPSSVTAESLSISPGQALLTMATTTVTGTTGRKVTVP
LHGIANDAGEITLVPISMNTTQDSTAESLVSLTAQSLIGASPKQTHLTKTQDAPLTGISK
PKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLD
QLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPGEVVAYNGDYEMT
DGDIEDATKTPNCSSEPVKEERGDLIKFYNAIYVGRVKSFALKYDLSNQDHIMDAPPLSP
FPHIKQQPGSPRRISQQHSIYVSPHKNASGLTPRSALLYKFNGSPSKKAKKRVIAISGDA
ESPAKRLCQENDDVLLKRLQDVVSERANH
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgttcgaggacgagccccacgccgagggggcggcagccgtcgccgcggccagggaggcg
ctgcaggccctgtgccaggagctgaacctggacgaggggagcgccgccgaagccctggac
gacttcaccgccatccgcggcaactacagcctagagggggaagttatacactggctggca
tgctctttgtacgtcgcttgccgcaagagcatcattcctaccgtgggaaagggcgtcatg
gaaggaaactgtgtttcgctgaccagaatactacgctcagctaagttaagcttaattcag
ttttttagtaaaatgaagaagtggatggacatgtcaaacctaccacaagaattccgggag
cgtatagaaaggctagaaagaaattttgaagtatctacagtaatttttaaaaaatttgag
cccatttttttagatatctttcaaaatccatatgaagagctaccaaagttgccacgaagc
agaaagcagaggaggattccttgcagtgttaaggatctctttaatttctgctggacgctc
ttcgtttacactaagggtaattttcgtatgattggtgatgatttagtaaactcatatcat
ttacttctgtgctgcttggacctgatttttgccaatgctataatgtgtccaaatagacga
gacttgttaaatccatcatttaaaggtttaccatcggatttccatgctgtgaacttcaaa
gctgcagaagaaccaccctgtatcattgctgtactttgcgatctgcacgatggactttta
gtagaagcaaaaggaataaaggagcactacttcaaaccatatatttcaaaactctttgac
aagaagattttaaaaggtgaatgtctcttggatctttccagttttactgataatagcaaa
gcagtgaacaaggagtatgaagagtatgttctaactgttggggactttgacgagaggatc
tttttgggagcagatgcagaggaggagatcggaacacctcgaaagttcgctgctgacacc
caatttgggaaactgacatcacaggccagtgtggactgcaaccttcaacaacactttgaa
aaaaaacggtcatttgcaccttctaccccacttactggacggcgctatttacaagaaaaa
gaggcagttaccacacctgttgcttcagctactcagagtgtaagccgattacagagcatt
gtagccggattgaaaagtgccccgagcgagcagcttctgactatttttgaatcttgtatg
cggaatccgatgggaaacattgtaaaaatagtgaaaggaataggagagactttctgccag
cactatacccagtccacagataaacagccaggatctcacatagactttgctgtaaacaga
ctgaaactggcagaaattttgtattataaaatactagagactataatggtccaggaaaca
cgacgacttcatggaatggacatgtcagttcttttagaacaagacatatttcacaggtcc
ttgctggcttgttgtttggaaattgtgctctttgcctatagctcaccccgtactttccct
tggatcattgacgttctcggtttgcagccgttttacttctataaggttattgaggtggtg
atccgctcagaggaggggctctccagagacatggtgaaacacctaaacagcattgaagag
cagattttggagagtttagcttggactaataattctgcactgtgggaagctctccgtgct
tctgcaaataaagttccttcctgtgaagaagttatattcccaaataactttgaaatagga
aatggaggaagtgtgcaaggccatcttcccatgatgccaatgtctccaataatacatcca
agagtcaaggaagttcgcactgacagtgggagccttcgaaaagatatgcagccactgtct
cccatctccgtccatgagcgctacagctcccctgccgcaggaagtgctaagaggagactc
tttggtgatgacccaccaaaggagacattgatggaaaagattatggcagaaggaacacag
ctgaaaattgctccttcaagtgtgactgctgaaagcttgtcaatttcccctgggcaagct
cttctcacaatggccacgaccacagtcacagggacgacgggacggaaggttaccgttcct
ttgcatggtattgccaatgatgctggagaaatcacactggttcctatttccatgaataca
actcaggactccacagctgagagccttgtatcactaactgcacagtcattaattggtgct
tctccaaaacagacccatctgactaaaacgcaagacgctcctctgaccggaataagcaaa
ccaaagagaactgggtccttagcactgttttatagaaaggtctatcatttggcaagtgta
cgcttacgtgatttatgtttaaaacttgatgtttcgaatgagttacgaaggaagatctgg
acatgttttgaattcactttagttcactgccctgatttaatgaaagataggcatttggat
cagctccttctgtgtgccttttacatcatggccaaagtaacaaaagaagaaagaactttt
caagaaataatgaaaagttacagaaatcagccacaagctaatagtcacgtatacaggagt
gttctcttgaaaagtattccaggagaagttgtggcatacaatggtgactatgagatgact
gatggtgacatagaagatgccacaaaaactcccaactgttccagtgaaccagtgaaagag
gaaagaggtgatcttatcaaattctacaatgcgatatatgtaggaagagtgaagtcattt
gcattgaagtatgatttgtccaatcaggaccatataatggatgctccaccgctctctcct
ttcccacatattaagcagcagccgggctccccacgccgcatttctcagcagcattccatt
tatgtctctccgcacaagaacgcatcaggcctcacccccaggagcgcactactctacaag
ttcaacggcagcccctctaagaaggccaagaagcgtgtgatcgccatcagcggagatgca
gagtcacctgccaaacgtctctgccaggagaacgatgatgttttacttaaacgactgcag
gatgttgtcagtgaaagagcgaatcattga

KEGG   Rattus norvegicus (rat): 81758
Entry
81758             CDS       T01003                                 

Gene name
Rbl2
Definition
(RefSeq) retinoblastoma-like protein 2
  KO
K16332  retinoblastoma-like protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    81758 (Rbl2)
   04151 PI3K-Akt signaling pathway
    81758 (Rbl2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    81758 (Rbl2)
   04218 Cellular senescence
    81758 (Rbl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81758 (Rbl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81758 (Rbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81758 (Rbl2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    81758 (Rbl2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB Myb_DNA-bind_5
Other DBs
NCBI-GeneID: 81758
NCBI-ProteinID: NP_112356
RGD: 3541
Ensembl: ENSRNOG00000012153
UniProt: O55081
Position
19
AA seq 1135 aa
MASGGNQSSPPPPAAAASSEEEEEDGDTADRAQPAGSPSHQIQQRFEELCSRLNMDEAAR
AEAWSSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRILRCSEQ
SLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPR
QQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQC
SNRKELVNPNFKGVSEDGHPRDSHPSSDPPCVIEKLCSLHDGLVLEAKGIKQHFWKPYIR
KLFEKKLLRGKEENLTGFLEPGNFAESFKAVNKAYEEYVLATGSLDERIFLGEDAEEEVG
TLSRCVSAASGTESAERTQMRDILQQHLDKSKTLRVCNPLTGVRYVQENSPCVTPVSTAT
HSLNRLHTMLAGLRNAPSEKLEQILRSCSRDPTRAIADRLREMYEIYSQHFQPDENVSNC
AKEMANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEQDAFHKSLLACCLEVVAFS
YKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKS
PLWDRIRDNENRVPTCEEVTPPHNLERTDEIYIAGSPLTPRRVGEVRTDAGGLGRSVTSP
TTLYDRYSSPTVSTTRRRLFESDSPSEGSTAGRIPPQPLVNAVPVQNVSGETVSVTPVPG
QTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQA
LAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNQGQPLTSSSIRPRKTSSLSLFFRKVY
YLAGVRLRDLCTKLDISDELRKKIWTCFEFSIVQCPELMMDRHLDQLLMCAIYVMAKVTK
EDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSCENRSHQNSPTELNTDRASRDSS
PVMRSNSTLPVPQPSSAPPTPTRLTGANSDIEEEERGDLIQFYNNIYRKQIQTFAMKYSQ
ANSQMDTPPLSPYPFVRTGSPRRVQLSQSHPIYISPHKNEAMLSPREKIFYYFSNSPSKR
LREINSMIRTGETPTKKRGILLDDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggcatctggaggcaaccagtcgtcacctccccctcctgctgctgcagccagctcagag
gaagaggaggaggatggcgacaccgcggaccgggcgcagcccgcagggtccccaagccat
cagatccaacagcggttcgaagagctgtgcagccgccttaacatggacgaggcggcacgc
gccgaggcctggagcagctaccgcagcatgagcgagagctacacgctggagggaaatgat
ctccattggttagcatgtgccttatatgtggcttgcagaaaatctgttcctactgtgagc
aaagggactgctgaaggaaactatgtgtctttaactagaatccttcgatgttctgagcaa
agcctaattgaattttttaacaagatgaagaagtgggaagatatggcaaatttaccccca
cacttccgagaacgaaccgaaagattagaaagaaacttcactgtctccgctgtgatcttt
aagaaatatgaacccatttttcaagacatttttaaatatccccaagaagaacaacctcgc
cagcaaagaggaagaaagcagaggcgacagccctgtaccacatctgaaattttccatttt
tgttgggtgctttttatatacgcaaaaggaaacttccccatgatcagtgatgatctggtc
aattcctaccatcttctgctgtgtgcactagatttagtttatggaaatgccctacaatgc
tctaaccggaaagaacttgtgaaccctaattttaaaggcgtgtccgaggacggccacccc
agggactctcacccgtcctctgatccaccgtgtgtcattgagaagctctgctccttacac
gacggcctagtgctggaggcaaaggggataaagcagcatttctggaaaccctacattagg
aagctttttgaaaagaagctcctcagggggaaggaagaaaatctcactggcttcctggag
cccgggaacttcgcagagagctttaaggctgttaataaggcgtatgaagaatacgtgtta
gccactgggagtctggatgagcggatatttcttggcgaggatgcggaggaggaagttgga
actctctcacggtgtgtaagtgctgcctcgggcacagagagtgccgaacgaacgcagatg
agagacatcttgcagcagcatcttgacaagtctaaaacacttagagtctgcaacccactg
actggcgtgcggtatgttcaggagaacagcccttgtgtgactcccgtctccacagcaaca
cacagcctgaaccgtcttcacaccatgctggccggcctcaggaatgcacccagtgagaag
ctagaacagatactcaggtcatgttcccgagatccgactcgggctatcgctgacaggttg
agagagatgtatgaaatatattctcagcatttccagccagacgagaatgttagtaattgt
gctaaagaaatggccaacaaacactttcgttttgcagaaatgctttactataaagtatta
gagtctgttattgagcaagaacagaagagattgggagacatggacttatctggtgttctg
gagcaagatgcattccataagtcactcctggcctgctgccttgaggtggtcgctttttcc
tataagcctcctggaaatttcccatttattgctgaaatatttgatgtaccacattatcat
ttttataaggtaatagaagtatttattagagcagaagacggtctttgcagagaagtggtc
aaacacctcaatcagattgaagaacaaattttagaccacttggcatggaaaaccaagtcc
ccactgtgggatagaattagagataatgaaaacagagtccctacatgtgaagaggttaca
ccacctcacaacctagagagaacagatgaaatctatattgctggctctcccttaactccg
agaagggtgggtgaagttcgcactgatgctggaggacttggaagaagtgtgacatctcca
accacattgtatgacaggtacagttccccaacagtcagtactactagaaggcggctattt
gagagtgacagtccctctgaaggaagcacggctgggcgcatccccccacaacccctagtc
aatgctgtccctgtgcagaatgtatctggggagactgtttctgtcacaccagttcctgga
cagaccttggtcaccatggcaacagccactgtcacagccaacaatggacaaacagtgacc
attccagtacaaggtattgccaacgaaaatggagggataacattcttcccagtccaagtg
aatgttgggggccaggcacaggctgtgactggctctatccagcccctcagtgctcaagcg
ctggctggaagtctgagttcccaacaggtgacaggaacaactttgcaagtccccggtccg
gtggccattcaacaaatttcccctggaggacaacagcagaaccaaggccagccgttaacc
agcagcagtatcaggcctcggaagactagctccttatcacttttctttagaaaggtttac
tacttagctggtgtccgccttcgagacctttgcacaaaactagatatttcagatgaactg
aggaaaaaaatttggacctgctttgaattctctatagtccagtgtcctgaacttatgatg
gacagacatctggaccagttgttaatgtgtgccatttacgtgatggcaaaggtcacaaaa
gaagacaagtccttccagaatatcatgcgctgttacaggactcagccacaggcccggagc
caggtatacagaagtgtcttgataaaagggaaaagaagaaattctggcagctgtgagaac
agaagccatcagaattctccaacagaactaaatacagacagagccagtagagactccagt
ccagttatgaggtcaaacagcaccttaccagttccacagcccagcagtgcccctcctaca
ccaactcgactcacaggtgccaacagtgacattgaagaggaggaaagaggagacctcatt
cagttctacaacaacatctacaggaaacaaatccaaacgtttgccatgaagtactcacag
gcaaactcccaaatggacacccctcccctgtctccctatccgtttgtaagaacgggctcc
cctcgccgagtacagttatctcaaagtcaccctatctacatttccccacataaaaacgaa
gcaatgctttctcctcgagagaagattttttactacttcagcaacagcccatcaaagaga
ctgagagaaattaacagtatgatacggacaggagagactccaactaaaaagagagggatt
ctcttggacgatggaagtgaatcgcctgcaaaaagaatttgcccagaaaatcattctgct
ctgttacgtcgtctccaagatgtagctaatgaccgaggttcacactga

DBGET integrated database retrieval system