KEGG   Rattus norvegicus (rat): 24717
Entry
24717             CDS       T01003                                 

Gene name
Rho
Definition
(RefSeq) rhodopsin
  KO
K04250  rhodopsin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    24717 (Rho)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24717 (Rho)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Vision
   Opsin
    24717 (Rho)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srsx TAS2R 7tm_4
Other DBs
NCBI-GeneID: 24717
NCBI-ProteinID: NP_254276
RGD: 3573
Ensembl: ENSRNOG00000011144
UniProt: P51489 A0A0G2JSY7
Position
4q42
AA seq 348 aa
MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASI
YNPIIYIMMNKQFRNCMLTTLCCGKNPLGDDEASATASKTETSQVAPA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaacggcacagagggccccaatttttatgtgcccttctccaacatcacgggcgtggtg
cgcagcccctttgagcagccgcagtactacctggcggagccatggcagttctccatgctg
gcagcctacatgttcctgctcatcgtgctgggcttccccatcaacttcctcacgctctac
gtcaccgtacagcacaagaagctgcgcacaccactcaactacatcctgctcaacttggct
gtggctgacctcttcatggtcttcggaggattcaccaccaccctctacacctcactgcat
ggctactttgtctttgggcccacaggctgcaaccttgagggcttctttgccacccttgga
ggtgaaatcggcctgtggtccctggtagtcctggccattgagcgctacgtggtggtctgc
aagcccatgagcaacttccgctttggggagaatcatgccattatgggtgtggccttcacc
tgggtcatggcgttggcctgtgctgctcccccactggttggctggtccaggtacatcccc
gagggcatgcagtgttcatgtgggattgactactatacactcaagcctgaggtcaacaat
gagtccttcgtcatctacatgttcgtggtccacttcaccatccccatgatcgtcatcttc
ttctgctacgggcagctggtcttcaccgtcaaggaggccgccgcccagcaacaggagtcg
gctaccactcagaaggcagagaaggaagtcacgcgcatggtcatcatcatggtcatcttc
ttcctgatctgctggcttccctatgccagtgtggccatgtacatctttacccaccagggc
tccaacttcggccccatcttcatgacccttcccgctttctttgctaagaccgcctccatc
tacaacccaatcatctacatcatgatgaacaagcagttccggaactgcatgctcaccacg
ctctgctgcggcaagaatccactgggagatgatgaggcctctgccactgcctccaagacg
gagaccagccaggtggctccagcctaa

DBGET integrated database retrieval system