KEGG   Rattus norvegicus (rat): 24718Help
Entry
24718             CDS       T01003                                 

Gene name
Reln, Reelen, Rl, reeler
Definition
(RefSeq) reelin
  KO
K06249  reelin [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    24718 (Reln)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    24718 (Reln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24718 (Reln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24718 (Reln)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     24718 (Reln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_2 BNR Reeler EGF_Tenascin hEGF
Motif
Other DBs
NCBI-GeneID: 24718
NCBI-ProteinID: NP_536319
RGD: 3553
Ensembl: ENSRNOG00000021441
UniProt: P58751
Position
4q11
AA seq 3462 aa AA seqDB search
MERGCWAPRTLVLAVLLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLIS
LHIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSIQSSQSIGGSSAFGFGIMSDH
QFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLC
EQGAPTEATAYSHLAEIHSDSVILRDDFDSYHQLELNPNIWAECSNCDTGEQCGTIMHGN
AVTFCEPYGPRELTTTYLNTTTASVLQFSIGSGSCRFSYSDPSIIVSYAKNNTADWIQLE
KIRAPSNVSTIIHILYLPEDAKGENVQFQWKQDSLRVGEVYEACWALDNILVINSAHRQV
ILEDSLDPVDTGNWLFFPGATVKHSCQSDGNAIYFHGNEGSQLNFATTRDVDLSTEDIQE
QWSEEFESQPTGWDILGAVVGSECGTIESGLSLVFLKDGERKLCTPYMDTTGYGNLRFYF
AMGGTCDPGDSHENDVILYAKIEGKKEHIALDTLSYSSYKVPTLVSVVINPELQTPATKF
CLRQKNHQGHNQNVWAVDFFHVLPILPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHG
RSWSLLHTECLPEICAGPHLPHSTIYSSENYSGWNRVTIPLPNAALTRDTRIRWRQTGPI
LGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSS
RLSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGS
KSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPRIISVELPDDAKQFGIQ
FRWWQPYHSSQGEDVWAIDEILMTSVLFNSISLDFTNLVEVTQSLGFYLGNIQPYCGHDW
TLCFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGL
TWHLVQDECLPSMPSCQEFTSASIYHASEFTQWRRVTVILPQKTWSGATRFRWSQSYYTA
QDEWALDDIYIGQQCPNMCSGHGSCDHGVCRCDQGYQGTECHPEAALPSTIMSDFENPSS
WDSDWQEVIGGEVVKPEQGCGVVSSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGG
ESAACNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFGKPRFVYLELPAAAKTPCTRFR
WWQPVFSGEDYDQWAVDDIIILSEKQKQVIPVVNPTLPQNFYEKPAFDYPINQMSVWLML
ANEGMAKNDSFCATTPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCASQFSSTAP
VLLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRVTIAIPRS
LASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQG
TCVSNIPNHSEMFDRFEGKLSPLWYKISGGQVGTGCGTLSDGRSLYFNGLGKREARTVPL
DTRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWHLLRELDFLSFLEPQ
IISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGVNDSSQTGFQDKFDGSIDLQA
NWYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASSFLQFDMSMGCSKPFSA
THSVQLQYSLNNGKDWHPVTEECVPPTIGCVHYTESSTYTSERFQNWRRVTVYLPLATNS
PRTRFRWIQANYTMGADAWAIDNVLLASGCPWLCSGRGICDSGRCVCDRGFGGPFCVPVV
PLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTN
TMYVQFSLRFIAKGTPERSHSILLQSSINGGVTWRLMDEFYFPQTTSILFINVPLPYSAQ
TNATRFRLWQPYNNGKKEEIWIIDDFIIDGDNLNNPVMLLDTFDFGPREDNWFFYPGGNI
GLYCPYSSKGAPEEDSAMVFVSNEIGEHSITTRDLSVNENTIIQFEINVGCSTDSSSADP
VRLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRREVVHFGKLH
LCGSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCCGHGSCVNGTKCICDPGYSGPT
CKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDL
DLSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIAL
EMPLKARSGSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFSTLDSRKWLLH
PGGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAASCSVTDSCYAIELE
YSVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPAYTRSQATRFRW
HQPAPFDKQQTWAIDNVYIGDGCLDMCSGHGRCIQGSCVCDEQWGGLYCDEPETSLPTQL
KDNFNRAPSNQNWLTVNGGKLSTVCGAVASGLALHFSGGCSRLLVTVDLNLTNAEFIQFY
FMYGCLITPSNRNQGVLLEYSVNGGITWTLLMEIFYDQYSKPGFVNILLPPDAKEIGTRF
RWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFD
MFMEDKTSVNENWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTENWIMQFK
ISVGCKVPEKIAQNQIHVQFSTDFGVSWSYLVPQCLPADPKCSGTVSQPSVFFPTKGWKR
ITYPLPESLMGNPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCGGHGDCLKEQCICDPGYS
GPHCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAENTALYFGGSTVRQAI
TQDLDLRGAKFLQYWGRIGSENNMTSCHRPVCRKEGVLLDYSKDGGITWTLLHEMDFQKY
ISVRHDYILLPEGALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEINPSQL
VDTFDDEGSSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGY
MMQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEAT
IYNAVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPRLCSGH
GYCTTGAVCICDESFQGDDCSVFSHELPSYIKDNFESARVTEANWETIQGGAIGSGCGQL
APYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSTAQTDSCNSDLSGPHTVDKA
VLLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQW
ALDHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
NT seq 10389 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcggctgctgggcgccgcggactctcgtcctggccgtgctgctgctgctgctg
gcgacgctgagggcgcgcgccgccacgggctactacccgcgcttctcgcccttctttttc
ctgtgcacccaccacggggagctggaaggggatggggagcagggcgaggtgctcatttcc
ctgcacattgcgggcaaccccacctactacgtaccgggacaggaataccatgttacaatt
tcaacaagcaccttcttcgatggcttgctggtgacgggactgtacacctcgacaagcatc
cagtcttctcagagcattggaggatccagtgcctttggatttgggatcatgtccgaccac
cagtttggtaaccagtttatgtgcagcgtggtggcctctcatgtgagtcacctgcctaca
acaaacctcagcttcgtctggatcgccccaccagctggcacgggctgtgtgaatttcatg
gctactgcaacacacaggggtcaggtgattttcaaagacgccttagcccagcagctctgt
gaacaaggagctcccacagaggccactgcttactcgcacctcgctgaaatacacagtgac
agtgtgattctacgagatgactttgactcctaccaccaactagaattgaaccccaatata
tgggctgaatgcagtaactgtgacactggagaacagtgtggcaccatcatgcatggcaac
gctgtcaccttctgtgagccatatggtcctcgagagttgactaccacatacctgaacacg
acaacagcatccgtcctccagttctccattgggtcaggatcctgtcgatttagctactct
gaccccagcatcattgtgtcatatgccaagaacaatactgccgattggattcagctcgag
aagattagagccccttccaacgtgagcaccatcatccatatcctctaccttcctgaggac
gccaaaggggagaacgtgcagttccagtggaaacaggacagcctgcgtgtgggtgaggtg
tacgaagcctgctgggccctggataacatcctggtcatcaattcggcccacagacaagtc
attctggaggacagcctcgacccagtagacacgggcaactggcttttcttccctggagca
acggtcaagcacagctgccagtcagatgggaacgccatatatttccacggaaatgaagga
agccagctcaattttgccaccacgcgggatgtagatctctccacagaggatattcaggag
cagtggtcagaagaatttgagagccagcccacaggatgggacatcttgggagcagtagtt
ggttcggaatgtggaaccattgagtcaggactctcactggtgttcctcaaagatggagag
aggaagctatgcaccccctacatggatacaactggttatggcaacctgaggttctacttc
gctatgggagggacctgtgaccctggagactctcatgaaaacgatgtcatcttatatgca
aagattgaaggaaaaaaagaacacatcgcactggacaccctttcctattcttcctataag
gttccaactttggtttctgtggtcatcaatcctgaacttcagacacctgccaccaaattt
tgtctcagacaaaagaaccaccaagggcataaccagaatgtctgggctgtggacttcttc
catgtgctgcccattctcccttccacaatgtctcacatgatccagttttccattaatctg
ggctgcggcacacaccagcctggtaacagcgtcagcttggagttttccactaaccatggc
cggtcctggtccctactccacaccgagtgtttgccggagatctgtgcaggtccccacctc
ccgcacagcaccatctactcctcggaaaactacagcgggtggaaccgagtcacgattccc
ctccctaatgcggcactcacccgagacaccaggattcgctggagacaaacaggacccatc
ctgggaaacatgtgggcaattgataatgtttatataggtccgtcatgcctcaaattctgt
tctggcagaggacaatgcactcgacatggttgcaagtgcgaccccggattttctggcccc
gcttgtgagatggcgtctcagaccttcccaatgtttatttcagaaagctttggcagttcc
agactttcctcctaccataacttttactctatccgtggtgctgaagtcagctttggctgt
ggtgtcttagccagtggtaaggctctggttttcaacaaagatgggcgacggcagctgatc
acctcctttctggatagctcgcagtccaggtttctgcagttcaccctgaggctggggagc
aagtctgttctgagcacgtgcagggcccctgaccagccaggggagggagttttgctgcat
tattcatatgacaatgggataacatggaaactcttggagcactattcatatctcaactac
cacgagcccaggatcatctccgtagagctaccagatgacgcgaagcagtttggaatccag
ttcagatggtggcagccgtaccattcttcccagggagaagatgtgtgggccattgacgag
atcctcatgacatcggtcctgttcaacagcatcagcctcgacttcaccaatcttgtggaa
gtcactcagtccctggggttctacctcggcaacatccagccatactgcggccatgactgg
acactttgttttacgggagattcgaaacttgcctcgagcatgcgctatgtggagacacag
tccatgcagattggagcgtcctatatgattcagttcagcctggtgatggggtgtggccag
aagtacactcctcacatggacaaccaggtgaagctggagtattccaccaaccacgggctc
acgtggcaccttgtacaagacgagtgccttcccagtatgccaagttgccaggaatttaca
tcggccagcatttaccacgccagtgagttcacacagtggagaagagtgaccgtcatcctt
ccccagaaaacatggtctggggccacccgcttccgttggagtcagagctattacacagcc
caggatgagtgggctttagacgacatttacattgggcagcaatgccccaacatgtgcagt
gggcatggctcatgtgaccacggcgtgtgcaggtgtgaccagggataccagggcactgaa
tgccacccggaagccgcacttccttccacgattatgtcagattttgagaacccgagcagt
tgggactcagactggcaagaagttattgggggagaagttgtaaaacctgagcaaggctgt
ggggtcgtgtcttccgggtcttctctgtacttcagcaaggccgggaagaggcagctggtg
agctgggatctggacacgtcctgggtggacttcgtgcagttctacatccagataggcgga
gagagtgccgcgtgcaacaaacctgacagccgagaggagggcgtcctcctccaatacagc
aacaatggcggcatccagtggcacctgctggcagagatgtacttctcagacttcggcaag
cccagatttgtctacctggaactcccagctgctgcgaagaccccttgtaccaggttccgc
tggtggcagcctgtgttctcaggggaggactatgaccagtgggccgtcgatgacatcatc
attctgtcagagaagcagaagcaggttatcccagttgtcaacccaactttgccccagaac
ttctatgagaagccagctttcgactaccctattaaccagatgagcgtgtggctgatgttg
gccaatgaagggatggctaagaacgatagcttctgtgccactacgccttcagccatggtg
ttcggaaagtcagacggagaccgattcgcagtgacgcgagatctgaccctgaaacccgga
tatgtgctccagttcaagctaaacatcgggtgtgccagccagttcagcagcactgctccg
gtcctcctgcagtattcacatgatgctggcatgtcctggtttctggtgaaggaggggtgc
tttcctgcctccgcgggcaagggatgtgaagggaactcccgggaactcagtgagcctact
gtctattacactggagactttgaagaatggacaagagtcaccattgccatcccgaggtcc
cttgcgtccagcaagaccagattccgatggatccaagagagcagctctcagaagaatgta
cccccatttggcttagatggggtatacatatctgagccttgtcccagctactgcagtggt
catggagactgcatctcaggggtgtgtttctgtgacctggggtacacagctgcacaagga
acgtgtgtgtccaacatccccaaccacagtgagatgttcgataggttcgaggggaagcta
agcccactgtggtacaaaatatccggaggtcaggttgggacgggctgtggaaccctcagt
gacggcaggtccctctacttcaatggccttgggaaaagggaagccaggacggtcccgctg
gacaccaggaatatcagacttgttcagttttatatacaaattggaagtaaaacgtcaggt
attacgtgcatcaaaccacgggctagaaacgaggggcttgttgttcagtattcaaatgac
aatgggatactctggcacttgctgcgggagttggacttcctgtcgttcctggagccacag
atcatttctattgacctgcctcgggaagccaagacacctgccacggccttccggtggtgg
cagccgcaacacgggaagcactcagcccagtgggctttggatgatgttcttataggagtg
aatgacagctctcaaactggatttcaagataaatttgatggctccatagacttgcaagcc
aattggtatcgaatccagggaggccaagttgacattgactgcctctctatggacaccgcc
ctcatattcaccgaaaacataggcaaacctcgctatgccgagacctgggacttccatgtg
tcagcctcaagcttcttacagtttgacatgagcatgggctgcagcaagcctttcagcgcc
acccacagtgtacagctccagtactccctgaacaacggcaaggactggcatcctgtcacc
gaagagtgtgtccctcctaccattggctgcgtgcactacacagagagttcaacttacacg
tcggaaaggttccagaactggaggcgggtcaccgtctaccttccactcgccaccaattct
ccgaggactcggttcagatggattcaggccaactacaccatgggagcagatgcctgggct
attgataatgtcctactggcctcaggctgcccttggctgtgctcaggacgaggcatttgt
gactcggggcgctgtgtgtgtgaccggggcttcggtggacccttctgtgttcctgtcgtt
cctctcccctccattctgaaagatgatttcaatgggaacttacatcctgacctttggcct
gaagtgtacggggcagagagggggaatctgaatggcgaaaccatcaaatccggaacatct
ctgatctttaaaggggagggactaagaatgcttatttcaagagacctggattgcaccaat
accatgtatgtccagttttctctccgatttatagcaaaaggtaccccggagaggtctcac
tccattctactgcaatcctccatcaatgggggggtcacctggcgcctgatggatgagttt
tacttccctcaaacaaccagcatacttttcattaatgtccccttgccgtacagcgcccaa
accaacgctacgagattcagactctggcagccgtacaacaacggtaagaaagaagaaatc
tggatcattgatgactttattattgatggggacaatctgaacaaccccgtgatgctgctg
gacacgttcgactttgggcccagggaagacaattggtttttctatccaggtggtaatatc
ggtctctactgcccgtattcttcaaagggggctcctgaggaggactcggccatggtgttc
gtttcaaacgaaatcggcgagcactccataaccacacgcgacctaagtgtgaacgagaac
accatcattcaattcgagatcaacgtcggatgctccactgatagctcgtctgctgatccg
gtcagactggaattttcaagggactttggagccacctggcacctgctgctgccgctctgc
taccacagcagcagcctcgtcagttcgctctgctccactgagcaccaccccagcagcacc
tactacgcggggaccacccagggctggaggagggaggtcgtgcacttcgggaagctgcac
ctttgcggatctgtgcgtttccgttggtaccagggattctatcccgccggctctcagccg
gtcacgtgggccattgataatgtctacattggtccccagtgcgaagagatgtgctgtggg
catgggagctgcgtcaatggaaccaagtgtatatgtgatcccggctactccggtccaacc
tgcaaaataagcaccaaaaatcctgattttctcaaagacgattttgaaggtcaactggaa
tccgatcgattcttactaatgagcggtgggaaaccttctcgaaaatgtgggatcctttcc
agtgggaacaacctcttcttcaatgaggatggcttgcgcatgctggtaacacgggacctg
gatctatcgcatgctaggtttgtgcagttcttcatgaggctgggatgcggtaaaggtgtt
ccggaccccaggagccagcccgtgcttctccagtactccctcaatggcggcctctcctgg
agccttcttcaagagttcctcttcagcaactccagcaatgtgggcaggtacatcgccctg
gaaatgcccctgaaagcccgctctggttctacacgcctccgctggtggcagccgtccgaa
aatgggcacttctatagcccctgggtgatcgaccagattcttattggaggaaatatctct
ggtaatacagtcttagaagatgatttctcgactctggacagcagaaagtggctgcttcac
ccaggaggcaccaagatgcccgtgtgtggctccacaggcgatgccctggtcttcattgaa
aaggccagcacccgttacgtggtcaccacggacattgccgtgaatgaggactcattccta
cagatagatttcgctgcgtcctgctcagtcacagactcctgctatgccattgaactggag
tactccgtggatctcgggctgtcgtggcaccccctagtgagggactgcctgcctaccaac
gtcgagtgcagtcgctatcacctgcagcggatcctggtgtcagatactttcaacaaatgg
accagaatcaccctgcccctccctgcctacaccaggtctcaagccactcgtttccgctgg
caccagccagcgccttttgacaagcagcagacgtgggcgatagataacgtctatattggg
gatggttgcctcgacatgtgcagtggccatgggaggtgcatccagggaagctgtgtctgt
gatgagcagtggggaggcctgtactgtgatgaacctgagacctcccttcccacccagctc
aaagacaacttcaatcgagctccctccaaccagaactggctgactgtgaatggtgggaaa
ttgagtactgtgtgtggagccgtggcttcgggcctggctctccacttcagtgggggctgt
agccgattgttagtcactgtggatctgaacctcactaatgctgagtttatccaattttac
ttcatgtatggatgcctcattacgccgagcaaccgtaaccagggagtcctgctggagtac
tccgtcaatggaggcatcacctggaccctgctgatggagattttctatgaccagtacagc
aagcctgggttcgtgaatatccttctccctcctgatgctaaagagattggtactcgcttc
cgctggtggcagccacgacatgatggccttgaccagaatgactgggccattgacaatgtc
ctcatctcaggctctgctgaccagaggacggtcatgctggacacgttcagcagtgcccca
gtgccacagcatgagcgttcccctgcagatgctggccccgttgggagaattgcttttgat
atgttcatggaggacaaaacctcagtgaatgagaattggctcttccatgatgactgtaca
gtagaaagattctgtgattccccagacggtgtcatgctctgtggcagccatgacggacga
gaggtgtacgcagtgacgcacgacctgactcccactgagaactggatcatgcaattcaag
atctctgttggatgcaaagtgcctgaaaaaattgcccaaaatcaaattcatgtgcagttt
tcaactgactttggcgtgagctggagttatctagtccctcagtgcttacccgccgaccca
aagtgttctgggaccgtctctcaaccatctgtgttctttccaacgaaagggtggaaaagg
atcacctacccgcttcctgaaagcttaatggggaatcctgtaagatttaggttctaccaa
aagtactcagacgtgcagtgggcaattgacaacttctaccttggccctgggtgtttggac
aactgtggaggccacggggactgcctaaaggaacagtgcatctgtgacccaggctactcg
gggccacactgctacttaactcacaccctgaagaccttcctgaaggaacgctttgacagt
gaagagatcaagcctgacttatggatgtccttagaaggcgggagcacttgcacagagtgc
gggatcctcgccgagaacactgcactctacttcgggggctccacggtgaggcaagctatt
actcaggacttagacctcagaggtgccaaattcctgcagtactggggacgcatcggcagt
gagaacaacatgacgtcttgccatcggccggtctgccggaaggagggcgtgctgctggac
tactctaaggatggaggaatcacttggactttgcttcatgagatggatttccagaaatac
atttcggtgaggcatgactacatcctcctccctgagggggccctcaccaacaccactcga
cttcgctggtggcagccttttgtgatcagcaatgggctcgtggtttccggggtggagcgt
gcgcagtgggccctggacaacattctgattggtggagcagaaatcaatccaagccaactg
gtggacacttttgatgacgaaggctcttcccatgaagaaaactggagtttttaccccaat
gcagtaaggacagcagggttctgtggcaatccatccttccacctctactggccgaacaaa
aaaaaggacaagacccacaatgctctctcctcccgcgagctcatcatacaaccaggatac
atgatgcaattcaaaattgtggtgggttgtgaagccacttcctgtggtgaccttcattcc
gtcatgctggagtacactaaggacgcaagatctgactcctggcagctcgtgcagacccag
tgcctaccttcctcttccaatagcatcggctgctcccccttccagttccacgaggccacc
atttataacgctgtcaacagctcgagctggaagaggatcaccatccagctgccagaccac
gtctcctcaagtgccacacagttccgctggatccagaaaggagaagaaacagagaagcaa
agctgggccatcgaccacgtgtacattggagaggcttgtcccaggctctgcagcggacat
ggttactgcaccacaggggccgtctgcatctgtgatgaaagcttccaaggtgacgactgc
tctgtcttcagtcacgagcttcccagttacattaaagataattttgaatcggcaagagtc
accgaagccaactgggaaacaatccagggaggcgccatcggaagtggctgtgggcagctg
gcgccctatgcccacggagactcgctctacttcaatggctgtcagataaggcaagccgcc
accaagccgctggacctcactcgagcaagcaaaattatgtttgtcttgcaaattgggagc
acggcacagacagacagttgcaacagcgacctcagcggcccccacacggtggacaaggca
gtgctgctgcaatacagcgtcaacaacggcatcacgtggcacgtcatcgctcagcaccag
ccgaaggacttcacacaagctcagcgggtgtcttacaacgttcccctggaagcacggatg
aaaggagttttgctgcgctggtggcagccacgacacaacggaacaggtcatgatcagtgg
gctttggaccatgtggaggtcgtcctagtaagcactcgcaaacaaaattacatgatgaat
ttttcacgacaacatgggctcaggcacttctacaaccgaaggcgaaggtcgcttaggcga
tacccatga

DBGET integrated database retrieval system