KEGG   Rattus norvegicus (rat): 24767
Entry
24767             CDS       T01003                                 

Gene name
Scnn1b, RNENACB
Definition
(RefSeq) sodium channel epithelial 1 beta subunit
  KO
K04825  amiloride-sensitive sodium channel subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24767 (Scnn1b)
  09157 Sensory system
   04742 Taste transduction
    24767 (Scnn1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24767 (Scnn1b)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   24767 (Scnn1b)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 24767
NCBI-ProteinID: NP_036780
RGD: 3640
Ensembl: ENSRNOG00000030981
UniProt: P37090
Position
1q36
AA seq 638 aa
MPVKKYLLKCLHRLQKGPGYTYKELLVWYCNNTNTHGPKRIICEGPKKKAMWFLLTLLFA
CLVCWQWGVFIQTYLSWEVSVSLSMGFKTMNFPAVTVCNSSPFQYSKVKHLLKDLYKLME
AVLDKILAPKSSHTNTTSTLNFTIWNHTPLVLIDERNPDHPVVLNLFGDSHNSSNPAPGS
TCNAQGCKVAMRLCSANGTVCTFRNFTSATQAVTEWYILQATNIFSQVLPQDLVGMGYAP
DRIILACLFGTEPCSHRNFTPIFYPDYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIG
QEDYVPFLASTAGARLMLHEQRTYPFIREEGIYAMAGTETSIGVLLDKLQGKGEPYSPCT
MNGSDVAIQNLYSDYNTTYSIQACLHSCFQDHMIHNCSCGHYLYPLPAGEKYCNNRDFPD
WAYCYLSLQMSVVQRETCLSMCKESCNDTQYKMTISMADWPSEASEDWILHVLSQERDQS
SNITLSRKGIVKLNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGE
IIIDFIWITVIKLVASCKGLRRRRPQRPYTGPPPTVAELVEAHTNCVFQPDTTSCRPNAE
VYPDQQTLPIPGTPPPNYDSLRLQPLDTMESDSEVEAI
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgccagtgaagaagtacctgctgaagtgcctgcacaggctgcagaagggcccaggctac
acctacaaggagctgctagtgtggtactgcaacaacaccaacacacacggccccaaacgc
atcatctgcgaggggcccaagaagaaggccatgtggttcctgctcacgctgctcttcgcc
tgcctggtgtgctggcagtggggcgtcttcatccagacctacctgagctgggaggtcagc
gtctcgctctccatgggcttcaagaccatgaacttcccagcagtcaccgtctgcaattcc
agccccttccagtactccaaggtcaagcacttgctgaaggacttgtacaagctgatggag
gctgtcctggacaagattctggctccgaagtccagccacaccaacaccaccagtaccctg
aactttaccatctggaaccacacgcccctggtccttattgatgagcggaaccctgaccat
ccagtggtcctcaacttgtttggggacagccacaacagcagcaacccagccccaggaagc
acctgtaatgcccaagggtgcaaagtggccatgaggctgtgcagtgccaatgggaccgtg
tgtaccttccgaaacttcaccagtgccacccaggccgtgactgagtggtacatcctgcag
gccaccaacatcttctcacaagtgctcccccaggacctggtggggatgggctatgctcct
gatcgcataatcctagcctgtctgtttggaacggagccctgcagtcatcggaacttcaca
cctatcttctaccctgattatggcaactgctacatcttcaactggggcatgacagagaag
gcacttccttctgccaaccctgggactgaatttggtctcaagttgatcctggacattggt
caggaggactatgtccccttccttgcgtccacagcaggggctaggctgatgctccacgag
cagaggacataccccttcattagagaagagggcatctatgccatggcaggaactgagact
tctattggggtgctgctggacaagctgcagggcaagggggagccatacagtccctgcacc
atgaacggctccgacgttgccattcagaacctctacagtgactacaacacgacctattcc
atccaggcctgccttcattcctgtttccaagaccacatgatccataactgcagctgtggt
cactacttgtaccctttgcctgctggggagaaatactgcaacaacagagacttcccagac
tgggcctactgctacctaagcctacagatgagtgtggtccagagagagacctgcctcagc
atgtgcaaggagtcctgcaacgacacccagtataagatgaccatctccatggctgactgg
ccatccgaggcctctgaggattggatcctacatgtcctgtctcaggagcgggaccagagc
tcaaatatcaccctgagcaggaagggtattgtcaagctcaatatctacttccaagagttc
aactaccgtaccatcgaggaatcgccggccaacaatatcgtgtggctgctctctaacctg
ggtggccagtttggcttctggatggggggctcggtgctgtgcctcattgagtttggggag
atcattatcgacttcatttggatcactgtcatcaagctagtggcctcctgtaaaggcctg
cgcaggaggcggccacagcgaccctacactggcccgccgcccactgtggccgagctggtg
gaggcccacaccaactgtgtcttccagcctgacacaaccagctgcaggcccaatgccgag
gtctaccctgaccaacagactctgcccattccgggcactccacctcccaactatgactcc
ctgaggctgcagccgctggacaccatggagtctgacagcgaggtggaggccatctag

DBGET integrated database retrieval system