KEGG   Rattus norvegicus (rat): 24768
Entry
24768             CDS       T01003                                 

Gene name
Scnn1g, ENaC
Definition
(RefSeq) sodium channel epithelial 1 gamma subunit
  KO
K04827  amiloride-sensitive sodium channel subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24768 (Scnn1g)
  09157 Sensory system
   04742 Taste transduction
    24768 (Scnn1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24768 (Scnn1g)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Epithelial sodium channel (ENaC)
   24768 (Scnn1g)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 24768
NCBI-ProteinID: NP_058742
RGD: 3641
Ensembl: ENSRNOG00000017842
UniProt: P37091
Position
1q36
AA seq 650 aa
MAPGEKIKAKIKKNLPVRGPQAPTIKDLMHWYCMNTNTHGCRRIVVSRGRLRPLLWIAFT
LTAVALIIWQCALLVFSFYTVSVSIKVHFQKLDFPAVTICNINPYKYSAVSDLLTDLDSE
TKQALLSLYGVKESRKRREAGSMPSTLEGTPPRFFKLIPLLVFNENEKGKARDFFTGRKR
KISGKIIHKASNVMHVHESKKLVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMA
QVPLEKKINMSYSAEELLVTCFFDGMSCDARNFTLFHHPMYGNCYTFNNKENATILSTSM
GGSEYGLQVILYINEDEYNPFLVSSTGAKVLIHQQNEYPFIEDVGMEIETAMSTSIGMHL
TESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPA
ANYCNYQQHPNWMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQWPSEASEKW
LLNVLTWDQSQQINKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWM
SCSVVCVIEIIEVFFIDFFSIIARRQWHKAKDCWARRQTPPSTETPSSRQGQDNPALDTD
DDLPTFTSAMRLPPAPGSTVPGTPPPRYNTLRLDRAFSSQLTDTQLTNEL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggcgcctggagagaagatcaaagccaaaatcaaaaagaatctgccggttcgaggcccc
caggcaccaaccattaaggacctgatgcattggtactgcatgaacaccaacacccacggg
tgccgccgcatcgtggtgtcccgaggccgccttcggcctctgctgtggatcgcgttcacg
ctaactgcagtggccctcattatctggcagtgcgccctcctcgtcttctctttctacacc
gtctctgtctccatcaaagtccacttccagaaactggatttccctgccgtcactatctgc
aatatcaacccttacaagtacagtgctgtgagtgaccttctgactgacttggacagtgag
acaaaacaggccttgctgtccttgtatggggtcaaagaatctcggaaacgccgggaagca
ggatccatgccgtccaccttggaaggcacaccacccagattcttcaaactgatcccactg
ctggtcttcaatgagaatgagaagggaaaggccagggacttcttcactggccggaagcgg
aaaatcagcgggaaaatcattcacaaagcttctaatgtcatgcacgttcatgagtcgaag
aaactggtgggatttcaattgtgctcaaatgatacctctgactgcgccacctacaccttc
agctcaggaatcaatgccatccaggagtggtacaagcttcactacatgaatatcatggca
caggtgcctctagagaagaaaatcaacatgagctattctgccgaagaactgctggtgacc
tgcttcttcgatgggatgtcctgtgatgccaggaacttcacgcttttccaccatccaatg
tatgggaactgctacacatttaacaacaaagaaaatgccaccatcctcagcacctccatg
ggaggcagtgagtacgggctgcaagtcatcttatacataaacgaagatgaatacaacccc
ttcctggtgtcctccactggagccaaggtgcttatccatcagcagaatgaataccccttc
atcgaagacgtggggatggagatcgagacagcaatgtccacttccataggaatgcacctg
acagaatccttcaagctgagcgaaccttacagccagtgcacagaggacggcagtgatgtg
cccgtcacaaacatctacaacgctgcctactccctccagatctgcctttattcatgcttc
caaacaaagatggtggaaaaatgtggctgcgcccagtacagccagcctctgcctccagca
gccaattactgcaactaccagcaacaccccaactggatgtattgctactaccagttgtac
caggcctttgtccgggaagaactgggctgccaatcagtgtgcaagcaatcctgtagcttt
aaggaatggacactgaccaccagcttggcacaatggccgtctgaggcttccgagaaatgg
ttgctgaatgttctcacctgggaccaaagccagcaaataaacaaaaagctcaacaagact
gacctggccaagctcttgatattctacaaagacctgaaccaaagatccatcatggagagc
ccagccaacagtattgagatgctcctgtccaactttggtggacagctcggcctgtggatg
agctgttcagtcgtctgtgtcattgaaatcattgaagtcttcttcattgacttcttctct
atcatcgcccgccgtcagtggcacaaagccaaggattgttgggcccgtaggcagacaccg
ccctccactgagactccctccagccggcaaggccaggataatccagctctggatacggac
gatgacctgcccacttttacctctgctatgcgcctgcctccagccccggggtccacggtg
cctggcacaccacctcccagatacaataccttgcgcttggatagagccttttcatcccag
ctcacagacactcagttgaccaatgagttgtaa

DBGET integrated database retrieval system