KEGG   Rattus norvegicus (rat): 24770
Entry
24770             CDS       T01003                                 

Gene name
Ccl2
Definition
(RefSeq) C-C motif chemokine 2 precursor
  KO
K14624  C-C motif chemokine 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05135  Yersinia infection
rno05142  Chagas disease
rno05144  Malaria
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    24770 (Ccl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24770 (Ccl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24770 (Ccl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    24770 (Ccl2)
   04657 IL-17 signaling pathway
    24770 (Ccl2)
   04062 Chemokine signaling pathway
    24770 (Ccl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24770 (Ccl2)
   05164 Influenza A
    24770 (Ccl2)
   05168 Herpes simplex virus 1 infection
    24770 (Ccl2)
   05163 Human cytomegalovirus infection
    24770 (Ccl2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24770 (Ccl2)
  09174 Infectious disease: parasitic
   05144 Malaria
    24770 (Ccl2)
   05142 Chagas disease
    24770 (Ccl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24770 (Ccl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24770 (Ccl2)
   05418 Fluid shear stress and atherosclerosis
    24770 (Ccl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24770 (Ccl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24770 (Ccl2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24770 (Ccl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   24770 (Ccl2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   24770 (Ccl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 24770
NCBI-ProteinID: NP_113718
RGD: 3645
Ensembl: ENSRNOG00000007159
UniProt: P14844
Position
10
AA seq 148 aa
MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCP
KEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLT
HKSEANASTLFSTTTSSTSVEVTSMTEN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcaggtctctgtcacgcttctgggcctgttgttcacagttgctgcctgtagcatccac
gtgctgtctcagccagatgcagttaatgccccactcacctgctgctactcattcactggc
aagatgatcccaatgagtcggctggagaactacaagagaatcaccagcagcaggtgtccc
aaagaagctgtagtatttgtcaccaagctcaagagagagatctgtgctgaccccaataag
gaatgggtccagaagtacattagaaaactggaccagaaccaagtgagatcagaaactaca
gtcttctataaaattgcatcaaccctaaggacttcagcacctttgaatgtgaacttgacc
cataaatctgaagctaatgcatccactctcttttccacaaccacctcaagcacttctgta
gaagtgaccagtatgacagagaactag

KEGG   Rattus norvegicus (rat): 287562
Entry
287562            CDS       T01003                                 

Gene name
Ccl12
Definition
(RefSeq) chemokine (C-C motif) ligand 12 precursor
  KO
K14624  C-C motif chemokine 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05135  Yersinia infection
rno05142  Chagas disease
rno05144  Malaria
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    287562 (Ccl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287562 (Ccl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287562 (Ccl12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    287562 (Ccl12)
   04657 IL-17 signaling pathway
    287562 (Ccl12)
   04062 Chemokine signaling pathway
    287562 (Ccl12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    287562 (Ccl12)
   05164 Influenza A
    287562 (Ccl12)
   05168 Herpes simplex virus 1 infection
    287562 (Ccl12)
   05163 Human cytomegalovirus infection
    287562 (Ccl12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    287562 (Ccl12)
  09174 Infectious disease: parasitic
   05144 Malaria
    287562 (Ccl12)
   05142 Chagas disease
    287562 (Ccl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    287562 (Ccl12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    287562 (Ccl12)
   05418 Fluid shear stress and atherosclerosis
    287562 (Ccl12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    287562 (Ccl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    287562 (Ccl12)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    287562 (Ccl12)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   287562 (Ccl12)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   287562 (Ccl12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 287562
NCBI-ProteinID: NP_001099292
RGD: 1309255
Ensembl: ENSRNOG00000029768
UniProt: D4ABS1
Position
10
AA seq 98 aa
MKISTLLCLLLIAAAISPQVLAGPDSVFTPVTCCYNVAKQKIHIRRLKSYRKITSSQCPR
EAVIFRTVLDKELCADPKEKWVKDSMNHLDQKSRTQHP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaagatctccacccttctttgccttctgctcatagctgccgccatcagcccacaggtg
ttggctggaccagattcagtgttcaccccagtcacctgctgttataatgtcgctaagcag
aagatccacattcggaggctaaagagctacaggaaaatcacaagcagccagtgtccccgg
gaagctgtgatcttcagaactgtactggataaggagctctgtgctgaccccaaggagaag
tgggttaaggactccatgaaccacttggatcagaagtctcgaactcagcatccttga

DBGET integrated database retrieval system