KEGG   Rattus norvegicus (rat): 24772
Entry
24772             CDS       T01003                                 

Gene name
Cxcl12
Definition
(RefSeq) stromal cell-derived factor 1 isoform beta precursor
  KO
K10031  C-X-C motif chemokine 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04360  Axon guidance
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    24772 (Cxcl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24772 (Cxcl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24772 (Cxcl12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24772 (Cxcl12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    24772 (Cxcl12)
   04672 Intestinal immune network for IgA production
    24772 (Cxcl12)
   04062 Chemokine signaling pathway
    24772 (Cxcl12)
  09158 Development and regeneration
   04360 Axon guidance
    24772 (Cxcl12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24772 (Cxcl12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    24772 (Cxcl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24772 (Cxcl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24772 (Cxcl12)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24772 (Cxcl12)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   24772 (Cxcl12)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Chemokines
   24772 (Cxcl12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 24772
NCBI-ProteinID: NP_001029054
RGD: 3651
Ensembl: ENSRNOG00000013589
Position
4
AA seq 93 aa
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atggacgccaaggtcgtcgccgtgctggccctggtgctggccgcgctctgcatcagtgac
ggtaagccagtcagcctgagctacagatgcccctgccgattctttgagagccatgtcgcc
agagccaacgtcaaacatctgaaaatcctcaacactccaaactgtgcccttcagattgtt
gcaaggctgaaaagcaacaacagacaagtgtgcattgacccgaaattaaagtggatccaa
gagtacctggacaaagccttaaacaagaggctcaagatgtga

DBGET integrated database retrieval system