KEGG   Rattus norvegicus (rat): 24778Help
Entry
24778             CDS       T01003                                 

Gene name
Slc2a1, GLUTB, GTG1, Glut1, Gtg3, RATGTG1
Definition
(RefSeq) solute carrier family 2 member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04911  Insulin secretion
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04976  Bile secretion
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24778 (Slc2a1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24778 (Slc2a1)
   04922 Glucagon signaling pathway
    24778 (Slc2a1)
   04920 Adipocytokine signaling pathway
    24778 (Slc2a1)
   04919 Thyroid hormone signaling pathway
    24778 (Slc2a1)
  09154 Digestive system
   04976 Bile secretion
    24778 (Slc2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24778 (Slc2a1)
   05230 Central carbon metabolism in cancer
    24778 (Slc2a1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    24778 (Slc2a1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24778 (Slc2a1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24778 (Slc2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24778 (Slc2a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC2: Facilitative GLUT transporter
   24778 (Slc2a1)
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    24778 (Slc2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Motif
Other DBs
NCBI-GeneID: 24778
NCBI-ProteinID: NP_620182
RGD: 3704
Ensembl: ENSRNOG00000007284
UniProt: P11167
Position
5q36
AA seq 492 aa AA seqDB search
MEPSSKKVTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWNHRYGESIPSTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEEGRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAVAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagcagcaagaaggtgacgggccgccttatgttggccgtgggaggggcagtg
ctcggatccctgcagttcggctataacaccggtgtcatcaacgccccccagaaggtaatt
gaggagttctacaatcaaacatggaaccaccgctatggagagtccatcccatccaccaca
ctcaccacactctggtctctctccgtggccatcttctctgtcgggggcatgattggttcc
ttctctgtgggcctctttgttaatcgctttggcaggcggaactccatgctgatgatgaac
ctgttggcctttgtgtctgccgtgcttatgggtttctccaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcattggagtgtactgtggcctgaccaccggctttgtg
cccatgtatgtgggggaggtgtcacccacagctcttcgtggagccctgggcaccctgcac
cagctgggcatcgtcgttgggatccttattgcccaggtgttcggcttagactccatcatg
ggcaatgcagacttgtggcctctactgctcagtgtcatcttcatcccagccctgctacag
tgtatcctgttgcccttctgccctgagagcccccgcttcctgctcatcaatcgtaacgag
gagaaccgggccaagagtgtgctgaaaaagcttcgagggacagccgatgtgacccgagac
ctgcaggagatgaaagaagagggtcggcagatgatgcgggagaagaaggtcaccatcttg
gagctgttccgctcacccgcctaccgccagcccatcctcatcgccgtggtgctgcagctg
tcccagcagctgtcgggcatcaatgctgtgttctactactcaacgagcatcttcgagaag
gcaggtgtgcagcagcctgtgtatgccaccatcggctcgggtatcgtcaacacggccttc
actgtggtgtcgctgttcgtcgtggagcgagctggccgtcggaccctgcatctcattggt
ctggctggcatggcgggctgtgctgtgctcatgaccatcgccctggccctgctggagcag
ctgccctggatgtcctatctgagtatcgtggccatctttggctttgtggccttctttgaa
gtaggccctggtcctattccatggttcattgtggccgagctgttcagccaggggccccga
cctgctgctgttgctgtggctggcttctctaactggacctcaaacttcatcgtgggcatg
tgcttccaatatgtggagcaactgtgtggcccctacgtcttcatcatcttcacggtgctg
ctggtactcttcttcatcttcacctacttcaaagttcctgagaccaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggtgccagccagagcgacaagacacctgag
gagctcttccaccctctgggggctgactcccaagtgtga

DBGET integrated database retrieval system