KEGG   Rattus norvegicus (rat): 24779Help
Entry
24779             CDS       T01003                                 

Gene name
Slc4a1
Definition
(RefSeq) solute carrier family 4 (anion exchanger), member 1
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    24779 (Slc4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24779 (Slc4a1)
   04147 Exosome [BR:rno04147]
    24779 (Slc4a1)
   04090 CD molecules [BR:rno04090]
    24779 (Slc4a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   24779 (Slc4a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24779 (Slc4a1)
CD molecules [BR:rno04090]
 Proteins
  24779 (Slc4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto WTF
Motif
Other DBs
NCBI-GeneID: 24779
NCBI-ProteinID: NP_036783
RGD: 3710
Ensembl: ENSRNOG00000020951
UniProt: P23562 Q5U329 F8WFT7
Position
10q32.1
AA seq 928 aa AA seqDB search
MGDMQDHEKVLEIPDRDSEEELEHVIEQIAYRDLDIPVTEMQESEALPTEQTATDYIPTS
TSTSHPSSSQVYVELQELMMDQRNQELQWVEAAHWIGLEENLREDGVWGRPHLSYLTFWS
LLELQKVFSKGTFLLDLAETSLAGVANKLLDSFIYEDQIRPQDRDELLRALLLKRSHAED
LKDLEGVKPAVLTRSGAPSEPLLPHQPSLETKLYCAQAEGGSEEPSPSGILKIPPNSETT
LVLVGRASFLVKPVLGFVRLKEAVPLEDLVLPEPVSFLLVLLGPEAPHIDYTQLGRAAAT
LMTERVFRVTASLAQSRGELLSSLDSFLDCSLVLPPTEAPSEKALLNLVPVQKELLRKRY
LPRPAKPDPNLYEALADGGKEGPGDEDDPLRRTGRIFGGLIRDIRRRYPYYLSDITDALS
PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVL
GFSGPLLVFEEAFYSFCESNNLEYIVGRAWIGFWLILLVVLVVAFEGSFLVQYISRYTQE
IFSFLISLIFIYETFSKLIKIFQDYPLQESYAPVVMKPKPQGPVPNTALLSLVLMVGTFL
LAMMLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDTFIKNTYTQKLSVPDGLKVSNS
SARGWVIHPLGLYNHFPKWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFH
LDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASGPGAAAQIQEVKEQRISG
LLVSVLVGLSILMEPILSRIPLAVLFGIFLYMGITSLSGIQLFDRILLLFKPPKYHPDVP
FVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRLLLPLIFRELEL
QCLDGDDAKVTFDEAEGLDEYDEVPMPV
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgggggacatgcaggaccacgagaaagtgctggagatcccagaccgtgacagtgaagag
gaactggaacatgtaatagaacagatagcatacagagacctagacatccctgtgacagaa
atgcaggagtcagaagctcttcccacagagcaaacagccacagactacatccccaccagt
acctccacatcgcacccaagctccagtcaggtctatgtagagctgcaggaactgatgatg
gaccagaggaaccaggaactacagtgggtggaggcggcacactggatagggctggaggaa
aaccttcgagaggatggtgtgtggggtcgtccacatctctcttacctcaccttctggagc
cttctagaactgcagaaggtcttctcaaaaggcaccttccttctggatctggcagagaca
tccctggctggggtggccaataaacttctagacagtttcatctatgaggatcaaattcgg
cctcaagaccgagatgagctgctccgggctctgctactcaaacgcagccacgctgaggac
ctaaaggatctggagggagtgaagcctgccgtcctgacccgctctggggccccttctgaa
cctcttcttcctcaccagccatcgctggagaccaagctgtactgtgcacaggcagagggg
ggctcagaagaaccctcgccatctgggattctgaagatcccccccaattcagaaaccaca
ttggtgctagtgggccgggctagtttcctggtgaagcctgtgctgggcttcgtgagactg
aaggaagctgtgccgctggaggacctggtgttgccggagcctgtgagcttccttctagtt
cttctcggacctgaggctccgcacatcgactacacccagctgggcagggctgcagcaact
ctcatgacagaaagagtgttccgcgttaccgcctccctggcgcagagccgaggggagctg
ctgagctccctggatagctttctggactgtagcctggtgctgccgcccacagaggcccct
tcagagaaagctctgctcaacctggtgcccgtgcagaaggagttgcttaggaagcggtac
ttgcccagacctgccaagccagaccccaacttgtacgaggcattagcagacgggggaaag
gagggccccggtgacgaagacgaccctctaaggcgcaccggccggatctttggaggcctg
atccgtgatatccggcgccggtatccttactacctgagtgacatcaccgatgcgctcagt
ccccaggtgctggctgctgtcatcttcatctactttgctgccttgtcacctgcggtcacc
ttcggcggtctcctgggagaaaagacccggaacctgatgggggtgtcagagctgctcatc
tccacagcagtgcaaggaattctctttgctctcctgggggcacagcccctgcttgtgctc
ggcttctcaggacccctgctggtgtttgaagaagccttctactcgttctgtgaaagcaat
aacctggagtacatcgtgggccgcgcgtggatcggcttctggcttatcctgctggtggtg
ttggtggtggcctttgaaggcagcttcctggtccaatacatctcccgctacactcaggag
atcttctccttcctcatctccctcatcttcatctatgagactttctctaagctgatcaag
attttccaggactacccgctacaagagagctatgcccctgttgtgatgaagcccaaacct
cagggccccgtgcccaacacagccctcctctcccttgtgcttatggttggtaccttccta
cttgccatgatgctacgaaagttcaagaacagcacctacttccccggcaagctacgcaga
gtcattggggactttggggtccccatctccatcctgataatggtcctggtggataccttc
atcaagaacacctacacgcagaaactctcggtgcctgatggccttaaagtgtccaactcc
tccgcccggggctgggtcatccatcccctgggtctgtataaccatttccccaagtggatg
atgtttgcttctgttctacccgctctgcttgtcttcatccttatattccttgagtctcag
atcaccacgctgattgtcagtaaacctgagcggaagatgatcaagggctccggcttccac
ctggacttgctgctggttgttggcatgggcggggtggccgccctctttgggatgccttgg
ctcagcgccaccactgtgcgttctgttacccatgccaacgccctcacagtcatggggaag
gccagtggtccaggggctgcagcccagatccaagaggtcaaggaacagcggatcagtggg
ctcctggtctctgtgctcgtgggactgtccattctcatggaacccatcctgtcccgcatc
cccctggccgtactgtttggcatcttcctgtacatggggatcacatccctcagtggcatc
cagctctttgaccgcatcttgctcctgttcaagccacccaagtaccacccagatgtgccc
tttgtcaagagggtgaagacctggcgtatgcacctcttcacgggcatccagatcatctgc
ctggctgtgctgtgggtggtgaagtccacgccagcctcgctggccctgccctttgtcctc
atcctcaccgtgcccctgcgtcgtctcctcctgccgctcatcttcagagagctagaactc
cagtgtctggatggtgatgatgccaaagtgacctttgacgaggcggaagggctggatgag
tatgacgaagtgcccatgcctgtgtga

DBGET integrated database retrieval system