KEGG   Rattus norvegicus (rat): 24781
Entry
24781             CDS       T01003                                 

Gene name
Slc4a3, Ae3, Aep3
Definition
(RefSeq) solute carrier family 4 member 3
  KO
K13856  solute carrier family 4 (anion exchanger), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24781 (Slc4a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   24781 (Slc4a3)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Other DBs
NCBI-GeneID: 24781
NCBI-ProteinID: NP_058745
RGD: 3712
Ensembl: ENSRNOG00000020138
UniProt: P23348
Position
9q33
AA seq 1227 aa
MANGVIPPPGGPSPLPQVRVPLEEPPLGPDVEEEDDDLGKTLAVSRFGDLISKTPAWDPE
KPSRSYSERDFEFHRHTSHHTHHPLSARLPPPHKLRRLPPTSARHARRKRKKEKTSAPPS
EGTPPIQEEGGAGAEEEEEEEEEEEGESEAEPVEPPPPGPPQKAKFSIGSDEDDSPGLSI
KAPCAKALPSVGLPSDQSPQRSGSSPSPRARASRISTEKSRPWSPSASYDLRERLCPGSA
LGNPGPEQRVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRIQGGRGSPSGL
APILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRETARWIKFEEDVEEETERWGKP
HVASLSFRSLLELRRTIAQGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRTL
LLKHSHPNDDKDSGFFPRNPSSSSVNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWPH
DPDAKEKPLHMPGGDGHRGKSLKLLEKIPEDAEATVVLVGSVPFLEQPAAAFVRLSEAVL
LESVLEVPVPVRFLFVMLGPSHTSTDYHELGRSIATLMSDKLFHEAAYQADDRQDLLGAI
SEFLDGSIVIPPSEVEGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYVAPGKELSL
EMGGSEATSEDDPLQRTGSVFGGLVRDVKRRYPHYPSDLRDALHSQCVAAVLFIYFAALS
PAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGPLLVFEEAFFKF
CRAQDLEYLTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFH
KLYKVFTEHPLLPFYPPEEALEPGLELNSSALPPTEGPPGPRNQPNTALLSLILMLGTFL
IAFFLRKFRNSRFLGGKARRVIGDFGIPISILVMVLVDYSITDTYTQKLTVPTGLSVTSP
HKRTWFIPPLGSARPFPPWMMVAAAVPALLVLILIFMETQITALIVSQKARRLLKGSGFH
LDLLLIGSLGGLCGLFGLPWLTAATVRSVTHVNALTVMRTAIAPGDKPQIQEVREQRVTG
VLIASLVGLSIVMGAVLRRIPLAVLFGIFLYMGVTSLSGIQLSQRLLLIFMPAKHHPEQP
YVTKVKTWRMHLFTFIQLGCIALLWVVKSTVASLAFPFLLLLTVPLRRCLLPRLFQDREL
QALDSEDAEPNFDEDGQDEYNELHMPV
NT seq 3684 nt   +upstreamnt  +downstreamnt
atggctaatggggtgatcccaccgcccggggggccctcccccctaccccaggtccgggtg
cccttggaggagcccccactgggtccagatgtagaagaggaggatgatgacttgggcaag
accttggctgtgagcaggtttggggacctcatcagcaagaccccggcctgggaccctgag
aagcctagccgcagctacagcgagcgcgactttgagtttcaccggcacacatcccaccac
acccatcacccgctctcagcccgcctgcctccaccccacaagctacggcgactgcccccc
acctctgctcggcacgccaggaggaagaggaagaaagagaaaacctctgctcccccctca
gaagggacaccccctatccaggaggaggggggagctggagcagaagaggaggaggaggaa
gaggaggaagaagagggagagtctgaggcagagcctgtggagcctccacccccagggcca
ccacagaaagcaaagttctccattggaagtgatgaggatgacagcccaggtctttctatc
aaggctccctgtgccaaggccctgccttccgtgggcctgccgtctgaccagagtccccag
cgctccggcagctcccccagtccccgggcccgggcttcccgaatctctacagagaagagt
cgaccctggagtccatcagccagctatgacctgcgggagcgattgtgcccaggcagtgcc
ctgggcaaccctgggccagagcagcgggtgcccactgatgaggcggaggctcaaatgctg
ggttctgccgatctggacgacatgaagagtcatcggctggaggacaaccccggagtgcgg
cgacacttggtgaagaaaccatcccggatacagggtgggagaggcagccccagtggcctg
gcgcccatcttgcgcaggaaaaagaagaagaagaagctggatcggaggcctcatgaggtg
ttcgtggagctgaatgaactgatgttggaccggagccaggagccacactggcgggagaca
gcacgctggatcaagttcgaagaggatgtggaggaggagacagagcgctgggggaagcct
catgttgcttcgctctccttccgtagcctcctggagcttaggaggaccattgcccaggga
gcggctctcctggacctggagcagaccaccctgccgggcatcgctcaccttgtggtggag
accatgattgtatctgaccagatccggcccgaggacagggctagcgttctgagaactctg
ctcctgaaacacagccatcccaacgatgacaaggacagtggctttttccctcgaaatccg
tcaagctccagtgtgaactcagtcttggggaatcaccacccaactcctagtcatggccct
gatggtgcagtacccaccatggctgatgacctaggggagccagccccattgtggccacat
gaccctgatgcaaaggagaagcccctccacatgcctgggggagacggtcaccgggggaaa
agcctgaaactgctggagaagatccctgaggacgctgaggccactgtcgtgcttgtgggc
agcgtgcctttcttggagcagccagcagcagcttttgtgaggctcagcgaggctgttctc
ttggagtctgtgctggaggtccccgtgcctgttcgcttcctcttcgtgatgctggggccc
agccataccagcaccgactatcacgagctagggcgctccattgccacgctcatgtctgac
aagctgtttcacgaggctgcctaccaggcagatgaccggcaggaccttttgggtgccatc
agcgagtttttggacggtagcattgtgattcccccatcggaggtagagggccgagaccta
ctccgttccgtggctgccttccagcgagagctgctgaggaagcgacgggagcgggaacag
accaaagtggagatgaccacccggggaggctatgtggcccctggcaaagaactgtctttg
gagatgggaggctccgaggcaacctctgaagatgatcccctgcagcggacaggctcagtg
tttggggggctagtacgggatgtgaagcgccggtacccacactaccccagtgacctacgg
gatgcactgcactctcagtgtgtggctgccgtgctgttcatttatttcgcagccctcagc
cctgctattacctttgggggtctgctaggagagaagactgaggggctgatgggtgtgtca
gagctgattgtgtccacggctgtgcttggggttctcttctctctgctgggggcccagccg
ctgctcgtggtgggcttctctggccctctgctggtcttcgaagaagctttcttcaagttc
tgccgagctcaggacctggaatacctcaccggtcgagtgtgggtgggcctctggctggtg
gtcttcgtcctggccctggtggcggctgagggcagcttccttgtccgctacatctcgcca
tttacccaggagatcttcgctttcctcatctcactaattttcatctatgagactttccac
aagctctataaggtgttcacagagcatcctttgctgcccttctacccaccggaggaggcc
ctggagcctggcttggaactgaatagtagtgccctgccccccacagagggaccaccaggt
ccccggaaccagcccaatacagctctgctgtccctcatcctcatgctggggactttcctc
attgccttcttcctgcgaaagttcaggaacagccgcttcctggggggcaaggctcggcgc
gtcatcggggacttcggcattcccatctccatcctggtgatggtccttgtggattactct
atcacagacacctacacacagaagctgacggtgcctacagggctctcagtgacttccccg
cataagcgcacgtggttcatcccacccttgggcagtgcccgccccttcccaccatggatg
atggtggctgctgctgtccctgcactcttggtcctcatcctgatattcatggagactcag
atcactgcgctcatcgtcagccagaaggcacggaggctactcaagggttccggcttccat
cttgacctgctgttgattggctctttgggtggcctctgtgggctcttcggcttgccctgg
ctcacagccgccactgtccgctctgtcacccatgtcaacgcgttgacggtgatgcgtact
gccattgcacctggtgacaagccccagatccaggaggtgcgggagcagcgagtcaccggg
gtgctcattgccagcctcgtgggtctgtctatcgtcatgggagctgtgctgcgcaggatc
ccgttggccgtgctctttgggattttcctgtacatgggagtcacatcactgtctggtatc
cagttgtcccagcgtctgctgctcattttcatgccagccaagcatcaccccgagcagccc
tacgtgaccaaggtgaagacatggaggatgcacctgttcaccttcatccagctgggctgc
atcgcgctcctctgggtggtcaagtcaacggtggcctcactggcctttcccttcctgctc
ttgctcacggtgcctctgaggcgttgccttttgccccggctcttccaggacagggagctg
caggcgctggactctgaagacgcagagccaaactttgatgaggatggtcaggatgagtac
aatgagctccacatgcctgtgtga

DBGET integrated database retrieval system