KEGG   Rattus norvegicus (rat): 24782Help
Entry
24782             CDS       T01003                                 

Gene name
Slc9a1, Nhe1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04976  Bile secretion
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24782 (Slc9a1)
   04024 cAMP signaling pathway
    24782 (Slc9a1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24782 (Slc9a1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    24782 (Slc9a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24782 (Slc9a1)
   04261 Adrenergic signaling in cardiomyocytes
    24782 (Slc9a1)
  09154 Digestive system
   04970 Salivary secretion
    24782 (Slc9a1)
   04971 Gastric acid secretion
    24782 (Slc9a1)
   04972 Pancreatic secretion
    24782 (Slc9a1)
   04976 Bile secretion
    24782 (Slc9a1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    24782 (Slc9a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24782 (Slc9a1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24782 (Slc9a1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24782 (Slc9a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   24782 (Slc9a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Motif
Other DBs
NCBI-GeneID: 24782
NCBI-ProteinID: NP_036784
RGD: 3718
Ensembl: ENSRNOG00000007982
UniProt: P26431
Position
5q36
AA seq 820 aa AA seqDB search
MMLRWSGIWGLYPPRIFPSLLVVVALVGLLPVLRSHGLQLNPTASTIRGSEPPRERSIGD
VTTAPSEPLHHPDDRNLTNLYIEHGAKPVRKAFPVLDIDYLHVRTPFEISLWILLACLMK
IGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYF
LPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINNIGLLDTLLFGSIISA
VDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYEYVGISDIFLGFL
SFFVVSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMAL
IASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHQWNWTFVIS
TLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPM
CDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIED
ICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGK
IPSAVSTVSMQNIHPKSAASERILPALSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVA
DPYEEAWNQMLLRRQKARQLEQKITNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPV
ITIDPASPQSPESVDLVNEELKGKVLGLKRGPRTTPEEEEEDEDGVIMIRSKEPSSPGTD
DVFTPGPSDSPGSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaaggtggtctggcatctggggactttatccacctcggatcttcccctccttg
ctggtggtggttgccttggtggggctgctacctgttctcaggagccacggcctccagctt
aaccctactgccagcaccatcagaggttctgaaccaccccgggaacgctcaattggggat
gtcaccacagctccatcagagcctctccaccacccagatgaccgcaatttgaccaactta
tacattgaacacggcgctaagccagttcgaaaggcctttccagtcctggacattgactac
ttacatgtacggacacccttcgagatctccctctggattctcctggcctgcctcatgaag
ataggtttccatgtgatccccaccatctcgagcatcgtcccggagagctgcctgctgatc
gtagtggggctgctggtggggggcctgatcaagggcgttggagagacgccccccttcctg
cagtcggacgtcttcttcctcttcctgctgccacccatcatcctggacgcaggctacttc
ctgcctctgaggcagttcacggagaacctgggcaccatcctgatctttgctgtggtgggc
acgctgtggaatgctttcttcctgggtggcctcctgtacgccgtgtgcctggtgggcggc
gagcagatcaataacatcggcctgctggacaccctgctgttcggtagcatcatctccgcg
gtggacccggtggccgtgctggccgtcttcgaggagatccacatcaatgagctgctgcac
atcctggtctttggggagtccctgctcaacgatgccgtcactgtggtcctctaccacctc
tttgaggagtttgccagctatgagtatgtgggcatctcggacatcttcctcggcttcctg
agcttctttgtcgtgtccctcggcggggtgtttgtgggcgtggtctacggggtcatcgca
gccttcacctcacgatttacctcccacatccgggtcatcgagccgctcttcgtcttcctt
tacagctatatggcttacctgtcagccgagctcttccacctgtctggaatcatggccctc
atcgcctcaggagtggtgatgcgcccctacgtggaggccaacatctcccacaaatcccac
accaccatcaagtacttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatc
ttccttggcgtctccaccgtggccggctcccaccagtggaactggacctttgtcatcagc
accctgctcttctgcctcatcgcccgggtgctgggggtcctggtcctgacctggttcatc
aacaagttccgaattgtcaagctgacccccaaggaccagttcatcattgcctatgggggc
ctgcgaggggccatcgccttctcactgggctacctcctggacaagaagcacttccccatg
tgtgatctgttcctcaccgccatcatcaccgtcatcttcttcacagtctttgtgcagggc
atgaccattcggcccctggtagacctgttggctgtgaagaaaaagcaagaaacaaagcgc
tccatcaacgaggagatccacacacagttcctggaccaccttctgacaggcatcgaggac
atctgtggtcattatggccaccatcactggaaggacaagctcaaccgctttaataagaag
tatgtgaagaagtgtctaatagctggagagcgctccaaggagccccagctcattgccttc
taccacaagatggagatgaagcaggccatcgagctggtggagagtgggggcatgggcaag
atcccatctgccgtctcaactgtctctatgcagaacatccaccccaagtctgcagcttca
gagcgcatcttgccagcgctgtctaaggacaaggaggaggagatccgcaaaatcctgagg
agtaacctgcagaaaacccggcaacggctgcggtcctataacagacacacgctggtggcc
gacccctacgaggaagcctggaaccagatgctgctccggaggcagaaggcccggcaactg
gagcagaagatcaccaactacctgacggtaccggcccacaagctggactcacccaccatg
tctcgggcccgcataggctcagacccactggcctatgaacccaaggccgacctccctgtc
atcaccatcgacccagcctccccgcagtcccccgagtctgtggacctggtgaatgaggag
ttgaagggcaaagtccttgggctaaagcggggtcctaggacgactccggaagaggaagag
gaagatgaggatggcgtcatcatgattcggagcaaggagccctcatccccaggcaccgat
gatgtcttcacccccggaccaagtgacagccccggctcccagagaatacaacgctgcctc
agtgacccgggcccccaccctgagcctggggagggagagcctttcatccccaaagggcag
tag

DBGET integrated database retrieval system