KEGG   Rattus norvegicus (rat): 24786
Entry
24786             CDS       T01003                                 
Symbol
Sod1
Name
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
rno04213  Longevity regulating pathway - multiple species
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05208  Chemical carcinogenesis - reactive oxygen species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24786 (Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    24786 (Sod1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    24786 (Sod1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24786 (Sod1)
   05014 Amyotrophic lateral sclerosis
    24786 (Sod1)
   05016 Huntington disease
    24786 (Sod1)
   05020 Prion disease
    24786 (Sod1)
   05022 Pathways of neurodegeneration - multiple diseases
    24786 (Sod1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     24786 (Sod1)
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 24786
NCBI-ProteinID: NP_058746
RGD: 3731
Ensembl: ENSRNOG00000002115
UniProt: P07632
Position
11:29456673..29462249
AA seq 154 aa
MAMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTT
AGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVV
HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcgatgaaggccgtgtgcgtgctgaagggcgacggtccggtgcagggcgtcattcac
ttcgagcagaaggcaagcggtgaaccagttgtggtgtcaggacagattacaggattaact
gaaggcgagcatgggttccatgtccatcaatatggggacaatacacaaggctgtaccact
gcaggacctcattttaatcctcactctaagaaacatggcggtccagcggatgaagagagg
catgttggagacctgggcaatgtggctgctggaaaggacggtgtggccaatgtgtccatt
gaagatcgtgtgatctcactctcaggagagcattccatcattggccgtactatggtggtc
cacgagaaacaagatgacttgggcaaaggtggaaatgaagaaagtacaaagactggaaat
gctggaagccgcttggcttgtggtgtgattgggattgcccaataa

DBGET integrated database retrieval system