KEGG   Rattus norvegicus (rat): 24792Help
Entry
24792             CDS       T01003                                 

Gene name
Agxt, AGT, SPT, Spat
Definition
(RefSeq) alanine-glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00250  Alanine, aspartate and glutamate metabolism
rno00260  Glycine, serine and threonine metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    24792 (Agxt)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24792 (Agxt)
   00260 Glycine, serine and threonine metabolism
    24792 (Agxt)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24792 (Agxt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    24792 (Agxt)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     24792 (Agxt)
    2.6.1.45  serine---glyoxylate transaminase
     24792 (Agxt)
    2.6.1.51  serine---pyruvate transaminase
     24792 (Agxt)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class V
   24792 (Agxt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 24792
NCBI-ProteinID: NP_085914
RGD: 2073
Ensembl: ENSRNOG00000023856
UniProt: P09139 Q5I0N5
Position
9q36
AA seq 414 aa AA seqDB search
MFRMLAKASVTLGSRAASWVRNMGSHQLLVPPPEALSKPLSIPKRLLLGPGPSNLAPRVL
AAGSLRMIGHMQKEMFQIMDEIKQGIQYVFQTRNPLTLVVSGSGHCAMETALFNLLEPGD
SFLVGTNGIWGIRAAEIAERIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLTHGES
STGVLQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDILYSGSQKVLNAPPGIS
LISFNDKAKSKVYSRKTKPVSFYTDITYLSKLWGCEGKTRVIHHTLPVISLYCLRESLAL
ISEQGLENSWRRHREATAHLHKCLRELGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSY
VLDHFNIEISGGLGPSEDKVLRIGLLGYNATTENADRVAEALREALQHCPKNKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgttccggatgttggccaaggccagtgtgacgctgggctccagggcagcaagttgggta
cggaacatgggctcgcaccagctgctggtgccacccccagaggccctgagcaagcccctg
tcaattcctaagaggctcctgttgggtccgggaccctccaacctggctcctcgtgtgcta
gcagctggaagtctgaggatgattggccacatgcaaaaagagatgtttcagatcatggat
gagatcaagcagggcatccagtatgtgttccagaccaggaaccccctcacactggttgtc
agcggctcaggacattgtgccatggagactgccctgttcaacctcctggagcctggggac
tcctttcttgtgggaaccaatggcatctgggggatacgggctgcagagatcgctgagcgg
attggagcccgtgtgcaccagatgatcaagaagcctggagaacattacacactgcaggag
gtggaggagggcctggctcagcataaaccagtgttgctgttcctgacccacggggagtca
tccactggtgtgctgcagcccctggatggtttcggggagctctgccacaggtatcagtgc
ctactcctggtggactcggtggcatcattgggcggagtccctatctacatggaccaacaa
ggcatcgacatcttgtactctggctctcagaaggtcctgaatgccccaccagggatctcc
ctcatctccttcaacgacaaggccaaatccaaagtctactcccggaagacaaagccagtc
tccttctacacagacatcacttatttgtccaagttgtggggctgtgagggcaagaccaga
gtaattcatcatacgttgcctgtcatcagcttatactgcctgagggagagcctagcactc
atttcagagcagggcctggagaattcctggcggcgtcacagggaggctacagcacatctg
cacaagtgcctgcgggagttgggcttaaagttctttgtgaaggacccggaaatccggcta
cctacaatcaccaccgtgaccgtgcctgccggctacaactggagggacatcgtcagctac
gtgctggaccacttcaacattgaaatctctggtggtcttgggccctctgaggataaggtg
ctgcggattggcctcctgggctacaacgccaccacagagaatgcggaccgtgtagcggag
gccctgagggaggccctgcaacattgtcctaagaataaattgtga

DBGET integrated database retrieval system