KEGG   Rattus norvegicus (rat): 24797Help
Entry
24797             CDS       T01003                                 

Gene name
Sst, SS-14, SS-28, Smst
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24797 (Sst)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24797 (Sst)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    24797 (Sst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Somatostatin
Motif
Other DBs
NCBI-GeneID: 24797
NCBI-ProteinID: NP_036791
RGD: 3761
Ensembl: ENSRNOG00000001837
UniProt: P60042
Position
11q23
AA seq 116 aa AA seqDB search
MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEP
NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctgccgtctccagtgcgcgctggccgcgctctgcatcgtcctggctttgggc
ggtgtcaccggggcgccctcggaccccagactccgtcagtttctgcagaagtctctggcg
gctgccaccgggaaacaggaactggccaagtacttcttggcagaactgctgtccgagccc
aaccagacagagaacgatgccctggagcctgaggatttgccccaggcagctgagcaggac
gagatgaggctggagctgcagaggtctgccaactcgaacccagccatggcaccccgggaa
cgcaaagctggctgcaagaacttcttctggaagacattcacatcctgttag

DBGET integrated database retrieval system