KEGG   Rattus norvegicus (rat): 24804
Entry
24804             CDS       T01003                                 

Gene name
Syp, Syp1
Definition
(RefSeq) synaptophysin
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MARVEL DUF588
Other DBs
NCBI-GeneID: 24804
NCBI-ProteinID: NP_036796
RGD: 3802
Ensembl: ENSRNOG00000059720
UniProt: P07825
Position
Xq12
AA seq 307 aa
MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALN
IEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATY
IFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQ
TGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPA
PGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAP
TSFSNQM
NT seq 924 nt   +upstreamnt  +downstreamnt
atggacgtggtgaatcagctggtggctgggggtcagttccgggtggtcaaggagcccctt
ggcttcgtgaaggtgctgcagtgggtctttgccatcttcgcctttgctacgtgtggcagc
tacaccggggagcttcggctgagcgtggagtgtgccaacaagacggagagtgccctcaac
atcgaagttgaattcgagtaccccttcaggctgcaccaagtgtactttgatgcaccctcc
tgcgtcaaagggggcactaccaagatcttcctggttggggactactcctcgtcggctgaa
ttctttgtcaccgtggctgtgtttgccttcctctactccatgggggccctggccacctac
atcttcctgcagaacaagtaccgagagaacaacaaagggcctatgatggactttctggct
acagccgtgttcgctttcatgtggctagttagttcatcagcctgggccaaaggcctgtcc
gatgtgaagatggccacggacccagagaacattatcaaggagatgcccatgtgccgccag
acagggaacacatgcaaggaactgagggaccctgtgacttcaggactcaacacctcagtg
gtgtttggcttcctgaacctggtgctctgggttggcaacttatggttcgtgttcaaggag
acaggctgggcagccccattcatgcgcgcacctccaggcgccccggaaaagcaaccagca
cctggcgatgcctacggcgatgcgggctacgggcagggccccggaggctatgggccccag
gactcctacgggcctcagggtggttatcaacccgattacgggcagccagccagcggtggc
ggtggctacgggcctcagggcgactatgggcagcaaggctatggccaacagggtgcgccc
acctccttctccaatcagatgtaa

DBGET integrated database retrieval system