KEGG   Rattus norvegicus (rat): 24807Help
Entry
24807             CDS       T01003                                 

Gene name
Tacr1, Tac1r
Definition
(RefSeq) tachykinin receptor 1
  KO
K04222  tachykinin receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24807 (Tacr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24807 (Tacr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24807 (Tacr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Tachykinin
    24807 (Tacr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 24807
NCBI-ProteinID: NP_036799
RGD: 3811
Ensembl: ENSRNOG00000005853
UniProt: P14600
Position
4q34
AA seq 407 aa AA seqDB search
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtccttcctatggactctgatctcttccccaacatctccaccaacacctct
gagtctaaccagttcgtgcagcctacctggcaaatcgttctttgggcggctgcctacacg
gtcatcgtggtgacttccgtggtgggcaacgtagtggtgatatggatcattttggcccac
aagagaatgaggacagtgaccaattatttcctggtgaacctggccttcgctgaggcctgc
atggctgcattcaatacggtggtgaacttcacctacgcagtccacaatgtgtggtactac
ggcctcttctattgcaagtttcacaacttcttccccatcgctgctctcttcgccagtatc
tactccatgacagccgtggccttcgacagatacatggccatcatccaccctctccagccc
cggctctcagccacggctaccaaagtggtcatctttgtcatctgggtcctggctctcctg
ctggcctttccacaaggctactactccaccacagagaccatgcccagcagagtcgtgtgc
atgatcgagtggccggagcatcccaacaggacttatgagaaagcgtaccacatctgcgtg
actgtactgatctacttcctgcctctactggtgatcggctacgcgtacactgtggtgggg
attacactgtgggccagtgagatccccggcgactcctctgaccgctaccatgagcaagtc
tctgccaaacgcaaggtggtcaaaatgatgatcgtggttgtgtgtaccttcgccatctgc
tggctgcccttccacgtcttcttcctcctgccctacatcaacccagatctctacctgaag
aagttcatccagcaggtctacctggccagcatgtggctggccatgagttctaccatgtac
aaccccatcatctactgttgcctcaacgacaggttccgtctgggcttcaagcacgccttc
cgctgctgccccttcatcagtgcaggtgattatgaggggctggaaatgaaatccacccga
tacctccagacacagagcagcgtgtacaaggtcagccgcctggagaccaccatctccact
gtggtgggagcccatgaagaggagcccgaggaaggccccaaggccacaccctcatccttg
gatctcacctccaacggctcctctcgcagcaactccaagaccatgacagaaagctccagc
ttctactctaacatgctggcctag

DBGET integrated database retrieval system