KEGG   Rattus norvegicus (rat): 24808Help
Entry
24808             CDS       T01003                                 

Gene name
Tacr3, Nkr, Nmkr, Tac3r
Definition
(RefSeq) tachykinin receptor 3
  KO
K04224  tachykinin receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24808 (Tacr3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24808 (Tacr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24808 (Tacr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Tachykinin
    24808 (Tacr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 SUa-2TM
Motif
Other DBs
NCBI-GeneID: 24808
NCBI-ProteinID: NP_058749
RGD: 3810
Ensembl: ENSRNOG00000009372
UniProt: P16177
Position
2q43
AA seq 452 aa AA seqDB search
MASVPRGENWTDGTVEVGTHTGNLSSALGVTEWLALQAGNFSSALGLPATTQAPSQVRAN
LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS
VAAFNTLINFIYGLHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP
RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII
LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL
PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW
CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLFDPNDGDPTKSSRKKRAVPRD
PSANGCSHRGSKSASTTSSFISSPYTSVDEYS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagtccccaggggcgaaaactggaccgacgggacggtggaagtggggacccat
acagggaatctgagctccgcgctgggggtcactgagtggcttgcgctccaagctggcaac
ttctcttcagcgctggggttgccggcgacaacccaggcaccttcccaggtccgggctaac
ctgaccaaccagttcgtgcagccgtcctggcggatcgcgctctggtccctggcctatggc
ttggtggtggccgtggcagtcttcggaaacctcatcgttatctggatcatcctagcccac
aagcgcatgagaactgtcaccaactatttcctggtaaacctggctttctccgacgcctcc
gtggctgccttcaacaccttgatcaatttcatctatggtcttcacagcgagtggtacttt
ggcgccaactactgccgcttccagaacttctttcccatcacagcggtgtttgccagcatc
tactctatgacagccattgcagtggacaggtatatggctattattgatccgttgaaaccc
agactttctgccacagccactaagattgtcattggaagtatttggattttggcatttcta
cttgccttccctcaatgcctttattccaaaataaaagtcatgccgggccgtactctttgc
tacgtgcagtggccagaaggtcccaagcaacatttcacgtaccacatcattgtgatcatc
ctggtgtactgtttcccactgctcatcatgggtgtcacctacaccatcgttggaattact
ctctggggaggagagatcccaggagacacctgtgacaagtaccatgagcagctgaaggct
aaacgaaaggtggtaaagatgatgatcattgtggtggtgacgtttgccatctgctggctg
ccctatcacgtgtatttcattctcactgcgatctaccaacagttaaacagatggaaatac
attcaacaggtctacctggctagcttctggctggcaatgagctcgaccatgtacaacccc
atcatctactgctgtttgaacaaaagattccgcgcaggcttcaagagagcatttcgctgg
tgtcctttcatccaagtctccagctacgatgagctggagctcaagaccaccaggtttcat
cccacacgacagagcagcctgtacaccgtgagcaggatggagtcggtgaccgtgctgttt
gaccccaatgatggagacccaaccaaatccagccgcaagaagagggcggtgcccagagac
cccagtgccaatggctgttcccacagaggttccaaatctgcctccaccacatcaagtttc
ataagctcaccctatacctctgtggatgaatattcctaa

DBGET integrated database retrieval system