KEGG   Rattus norvegicus (rat): 24811Help
Entry
24811             CDS       T01003                                 

Gene name
Tap1, Abcb2, Cim, Tap2
Definition
(RefSeq) transporter 1, ATP binding cassette subfamily B member
  KO
K05653  ATP-binding cassette, subfamily B (MDR/TAP), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04145  Phagosome
rno04612  Antigen processing and presentation
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    24811 (Tap1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24811 (Tap1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24811 (Tap1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    24811 (Tap1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24811 (Tap1)
   05168 Herpes simplex virus 1 infection
    24811 (Tap1)
   05163 Human cytomegalovirus infection
    24811 (Tap1)
   05169 Epstein-Barr virus infection
    24811 (Tap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24811 (Tap1)
Transporters [BR:rno02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    24811 (Tap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_16 ABC_ATPase AAA_23 AAA_29 AAA_22 AAA_15 AAA_30 SRP54 Zeta_toxin AAA_33 AAA_18 AAA_25 APS_kinase
Motif
Other DBs
NCBI-GeneID: 24811
NCBI-ProteinID: NP_114444
RGD: 3817
Ensembl: ENSRNOG00000000457
Vega: OTTRNOG00000001670
UniProt: P97949 P97561
Structure
PDB: 

Position
20p12
AA seq 725 aa AA seqDB search
MAAHAWPTAALLLLLVDWLLLRPVLPGIFSLLVPEVPLLRVWAVGLSRWAILGLGVRGVL
GVTAGARGWLAALQPLVAALGLALPGLASFRKLSAWGALREGDNAGLLHWNSRLDAFVLS
YVAALPAAALWHKLGGFWAPSGHKGAGDMLCRMLGFLDSKKGRLHLVLVLLILSCLGEMA
IPFFTGRITDWILQDKTAPSFARNMWLMCILTVASTALEFAGDGIYNITMGHMHSRVHGE
VFRAVLHQETGFFLKNPTGSITSRVTEDTSNVCESISDKLNLFLWYLGRGLCLLAFMIWG
SFYLTVVTLLSLPLLFLLPRRLGKVYQSLAVKVQESLAKSTQVALEALSAMPTVRSFANE
EGEAQKFRQKLEEMKPLNKKEALAYVTEVWTMSVSGMLLKVGILYLGGQLVVRGAVSSGN
LVSFVLYQLQFTRAVEVLLSIYPSMQKSVGASEKIFEYLDRTPCSPLSGSLAPLNMKGLV
KFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVL
LDGELLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHD
FISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDDATSALDAGNQLRVQR
LLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEAL
AAPSD
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcacgcctggccgacggccgccttgctgctgctgctggtggactggctgctg
ctgcggcccgtgctcccgggaatcttctccctgttggttcccgaggtgccgctgctccgg
gtctgggccgtgggcttgagtcgctgggctatcctgggactaggggtccgcggggtcctc
ggggtcaccgcgggagcccgtggctggctggctgctttgcagccgctggtggcggcgctg
ggtttggccctgcctggacttgcctcgttccgaaagctgtccgcctggggagcactccgg
gagggtgacaacgctggactgctccactggaacagtcgcttagatgccttcgttctcagt
tatgtggccgcattgcccgcagctgccctgtggcacaagttggggggcttctgggcgccc
agtggccacaagggcgctggagacatgctgtgtcggatgctaggcttcctggactccaag
aaggggcgtctccacctggttctggttctcttgatcctctcctgccttggggaaatggcc
attcccttcttcacaggccgcatcactgactggatccttcaggataagacagcccccagc
ttcgcccgcaacatgtggctcatgtgtattcttaccgtagccagtacagcgctggagttt
gcaggagatggaatctacaacatcaccatgggccacatgcacagccgcgtgcatggagag
gtgtttcgggccgtccttcaccaggagacaggatttttcctgaagaacccaacaggttcc
atcacatctcgggtgactgaggacacctccaacgtgtgcgagtccattagtgacaagctg
aacctgttcctgtggtacctggggcgaggcctgtgtctcctggcgttcatgatttggggg
tcattctacctcactgtggtcaccctgctcagcctgcctctgcttttccttctgcccagg
aggctggggaaagtgtaccagtcactggcagtgaaggtgcaggagtctctagcaaagtcc
acgcaggtggccctcgaggccctgtcggcgatgcctaccgtacggagctttgccaacgag
gagggagaggcccagaagtttaggcagaagttggaagaaatgaagccgctaaacaagaaa
gaggccctggcttacgtcaccgaagtctggaccatgagtgtctcgggaatgctgctgaag
gtgggaattctgtacctcggtgggcagctggtggtcagaggggctgtcagcagcggcaac
ctcgtctcctttgttctctaccagcttcagttcaccagggccgtggaggtcctgctctcc
atctatccctccatgcagaagtccgtgggcgcctcggagaaaatattcgaatacctggac
cggactccctgctctccgctcagtggctcactggcacctttaaacatgaaaggcctcgtc
aagttccaagatgtctcctttgcctacccaaaccatcccaacgtccaggtgcttcagggg
ctgacttttacgctgtatcccgggaaggtgactgccttggtgggacccaatgggtcaggg
aagagcaccgtggccgccctgctgcagaacctgtaccagcccaccgggggcaaggtgctc
ctggatggcgagctcctggtccagtatgatcaccactacctgcacacgcaggtggccgca
gtgggacaagagccactgctatttggaagaagttttcgggaaaatattgcctatggcctg
acgcggactccaaccatggaggaaatcacagctgtggccatggagtccggagcccacgat
ttcatctctggattccctcagggctatgacacagaggtaggtgaaactgggaaccagctg
tcaggaggtcagcgacaggcggtggccttggctcgagccttgatccggaagccacgcctg
cttatcttggacgatgccaccagtgccctggatgctggcaaccagctacgggtccagcgg
ctcctgtatgagagccccgagtgggcctctcggacggttcttctgatcacccagcagctc
agcctggcagagcgggcccaccacatcctcttcctcaaagaaggctctgtctgcgagcag
ggcacccacctgcagctcatggagagaggagggtgttaccggtccatggtggaggctctt
gcggctccttcagactga

DBGET integrated database retrieval system