KEGG   Rattus norvegicus (rat): 24812
Entry
24812             CDS       T01003                                 

Gene name
Tap2, Abcb3, Cim
Definition
(RefSeq) transporter 2, ATP binding cassette subfamily B member
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04145  Phagosome
rno04612  Antigen processing and presentation
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    24812 (Tap2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24812 (Tap2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24812 (Tap2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    24812 (Tap2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24812 (Tap2)
   05168 Herpes simplex virus 1 infection
    24812 (Tap2)
   05163 Human cytomegalovirus infection
    24812 (Tap2)
   05169 Epstein-Barr virus infection
    24812 (Tap2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24812 (Tap2)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    24812 (Tap2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_16 AAA_29 AAA_30 AAA_23 AAA_21 AAA_15 AAA_25 SRP54 Zeta_toxin AAA_33 RsgA_GTPase Thymidylate_kin AAA_18
Other DBs
NCBI-GeneID: 24812
NCBI-ProteinID: NP_114445
RGD: 3818
Ensembl: ENSRNOG00000000455
Vega: OTTRNOG00000001672
UniProt: P36372 Q6MGA3
Position
20p12
AA seq 703 aa
MALSYPRPWASLLLVDLALLGLLQRSLGTLLPPGLPGLWLEGTLRLGVLWGLLKVGGLLR
LVGTFLPLLCLTTPLFFSLRALVGSTMSTSVLRVASASWGWLLAGYVAAALSLAVWAVLS
PAGAQEKEPGQENNRALMIRLLRLSKPDLPFLIVAFIFLAMAVWGETLIPHYSGRVIDIL
GGDFDPDAFASAIFFMCLFSVGSSLSAGCRGGSFLFTMSRINLRIREQLFSSLLRQDLAF
FQETKTGELNSRLSSDTSLMSRWLPFNANILLRSLVKVVGLYYFMLQVSPRLTFLSLLDL
PLTIAAEKVYNPRHQAVLKEIQDVVAKAGQVVREAVGGLQTVRSFGAEEQEVSRYKEALE
RCRQLWWRRDLEKELYLVIRRVMALGMQVLILNCGVQQILAGEVTRGGLLSFLLYQEEVG
HHVRNLVYMYGDMLSNVGAAEKVFSYLDRRPNLPKPGTLAPPRVEGRVEFQDVSFSYPSR
PEKPVLQGLTFTLHPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHH
YLHRQVVLVGQEPVLFSGSVKDNIAYGLRNCEDAQVMAAAQAACADDFIGEMTNGINTEI
GERGSQLAVGQKQRLAIARALVRNPRVLILDEATSALDAECEQALQTWRSQEDRTMLVIA
HRLHTVQNADQVLVLKQGQLVEHDQLRDEQDVYAHLVQQRLEA
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcgctgtcctacccgaggccctgggcctctctgctgctggtggacctggctttactt
gggttgctacaaagatctctgggaactctgcttcccccggggctgccaggattatggctg
gagggcaccctgcgacttggagtgctgtggggactgctaaaagtgggagggctgctgaga
cttgtggggacctttctgcccttgctctgcctgaccacccccctgtttttctcgctgaga
gccctggtgggaagcaccatgagcacctcagtactcagagtggcttctgcctcttggggc
tggctgcttgctggctatgtagccgcggcgttgagccttgccgtgtgggctgtgctgagc
cccgctggagcacaggagaaggaaccaggccaggagaacaacagagcactcatgatacgg
ttgctgaggctgtccaagccggatctgcctttcctcattgttgccttcatctttcttgcg
atggctgtgtggggggagacgttaatccctcattattcgggtcgtgtgattgacatcctg
ggaggtgattttgacccagacgcctttgcgagcgccatctttttcatgtgcttattctct
gttgggagctccctctctgcaggctgccgaggaggctccttcctcttcaccatgtccagg
atcaaccttcgcatacgagagcagcttttctcatctttgttgcgccaagaccttgcattc
ttccaggagaccaagacaggggagctgaactcacggctgagctcggacacctccctgatg
agccgctggctccctttcaatgccaatatcctgctgcggagcctggtgaaggtggtgggg
ctgtactacttcatgctccaggtctccccgagactcaccttcctctccctgctggacctg
cccctcacaatagcagccgagaaggtgtacaacccccgccatcaggctgtgctaaaggag
atccaggatgtagtggcgaaggcagggcaggtggtgcgtgaggccgtaggagggctgcag
accgtgagaagctttggcgcggaggagcaggaagtcagccgctacaaggaggccctggag
cgatgtcgacagctgtggtggcgccgagacctggaaaaagaattgtatttagtcatacgg
agggtaatggccttgggcatgcaggtgctgattctgaactgcggtgtgcagcagatcctg
gctggggaggtcacccggggcggcctgctctccttcttgctgtatcaggaggaagtgggg
caccatgtccggaacctggtatacatgtatggggatatgctgagcaacgtgggtgccgcg
gaaaaggttttttcctacttggaccgaaggccaaatctgccgaagcctggtaccctggcc
cctcccagggtggaggggcgcgtggaatttcaagatgtctccttctcgtaccccagtcgc
cccgagaagcctgtgctccagggcctgacgtttaccctgcatcctggaaaggtgaccgcg
ttggtgggacccaatgggtcagggaagagcaccgtggccgccctgctgcagaacctgtac
cagccaaccgggggcaaggtgctcctggatggcgagcccctggtccagtacgatcaccac
tacctgcaccgccaggtggttctggtggggcaggagcctgtgctgttctccggttctgtc
aaggacaatattgcctatggcctgaggaactgtgaggatgctcaagtgatggctgctgcc
caggcggcctgtgcagacgacttcataggggaaatgacgaacggaataaacacagaaatc
ggggagagagggagccagttagctgtgggacagaagcaacgtctggccattgcccgggcc
cttgtgcggaacccgcgggtcctcatcctggatgaggctaccagtgccctggacgccgag
tgcgagcaggctcttcagacctggagatcgcaggaggacaggacgatgctggtcattgct
caccggctgcacacggttcagaatgctgaccaagttctggtgctcaagcaggggcagctg
gtggagcacgaccagctcagggatgagcaggatgtctacgctcacttggtacagcagcgg
ctggaagcgtga

DBGET integrated database retrieval system