KEGG   Rattus norvegicus (rat): 24813
Entry
24813             CDS       T01003                                 

Gene name
Tat
Definition
(RefSeq) tyrosine aminotransferase
  KO
K00815  tyrosine aminotransferase [EC:2.6.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00130  Ubiquinone and other terpenoid-quinone biosynthesis
rno00270  Cysteine and methionine metabolism
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
rno_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24813 (Tat)
   00350 Tyrosine metabolism
    24813 (Tat)
   00360 Phenylalanine metabolism
    24813 (Tat)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    24813 (Tat)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    24813 (Tat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    24813 (Tat)
Enzymes [BR:rno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     24813 (Tat)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class I
   24813 (Tat)
SSDB
Motif
Pfam: Aminotran_1_2 TAT_ubiq Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Asp_aminotransf
Other DBs
NCBI-GeneID: 24813
NCBI-ProteinID: NP_036800
RGD: 3820
Ensembl: ENSRNOG00000016348
UniProt: P04694
Position
19
AA seq 454 aa
MDSYVIQTDVDDSLSSVLDVHVNIGGRNSVQGRKKGRKARWDVRPSDMSNKTFNPIRAIV
DNMKVQPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
EVASYYHCHEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG
IEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
CVPILADEIYGDMVFSDCKYEPLANLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
FGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYHDTLSFLKSNADLCYGALAAI
PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggactcctacgtgattcagacggatgtcgacgacagcttgtcctcagttctggatgtg
catgtcaatattggtgggagaaactcggtacaaggaagaaagaaaggcaggaaggccaga
tgggacgtgagaccctctgacatgtccaataagaccttcaatcccatccgagccatcgtg
gacaacatgaaggtgcagcccaatccgaacaagaccgtgatttctctgtcaattggggac
cctactgtgtttgggaacctgcctacagaccctgaagttacccaagccatgaaagatgcc
ctggactcggggaagtacaatggctatgccccgtccatcggctacctatccagtcgggag
gaggtcgcttcttactaccactgtcatgaggctcctctggaagctaaggatgtcattctg
acaagcggctgcagtcaggccattgagctatgtctagctgtgttggccaatcctggacaa
aacatcctcattccaaggcccgggttttccctctataggactttggctgagtctatggga
attgaggtcaagctctacaatctcctgcccgagaagtcttgggaaattgacctaaaacaa
ctggaatctctgatcgatgaaaaaacagcgtgtcttgttgtcaacaacccatccaatccc
tgtggctccgtgttcagtaagcggcaccttcagaagattttggcagtggctgaaaggcag
tgtgtccccatcttagctgacgagatctatggtgacatggtgttttcagattgcaaatac
gaaccactggccaacctcagcaccaatgttcccatcctgtcctgtggtgggctggccaag
cgctggctggttcctggctggaggttgggctggatcctcattcatgatcgaagagacatt
tttggcaatgagattcgagacgggctggtgaaactgagtcagcggatcctgggaccatgc
accatagtccagggtgctctgaagagcatccttcagcgaacccctcaggagttctatcac
gacacgttaagcttcctcaagtccaatgcggacctctgctatggggcactggctgccatc
cctggactccagccggtccgcccttctggagccatgtaccttatggtgggaattgagatg
gagcatttcccggaattcgagaacgacgtggagttcacagagcggttgattgcggagcag
gctgtccactgtctcccagcaacgtgcttcgagtacccaaatttcttccgagtggtcatc
acagtccccgaggtgatgatgctggaggcttgtagccggatccaggagttctgtgaacag
cactaccactgtgctgaaggcagccaggaggagtgtgacaaataa

DBGET integrated database retrieval system