KEGG   Rattus norvegicus (rat): 24825Help
Entry
24825             CDS       T01003                                 

Gene name
Tf, Tfn, Trf
Definition
(RefSeq) transferrin
  KO
K14736  transferrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04216  Ferroptosis
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24825 (Tf)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    24825 (Tf)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    24825 (Tf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24825 (Tf)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24825 (Tf)
  Exosomal proteins of colorectal cancer cells
   24825 (Tf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 24825
NCBI-ProteinID: NP_001013128
RGD: 3845
Ensembl: ENSRNOG00000030625
UniProt: P12346
Position
8q32
AA seq 698 aa AA seqDB search
MRFAVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVK
KTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEFYGSLEHPQTHYLAVAVV
KKGTDFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLPEPRKPLEKAVASFFSGSCVPC
ADPVAFPQLCQLCPGCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTIFEVLPQKADRD
QYELLCLDNTRKPVDQYEDCYLARIPSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSKD
FQLFGSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPV
KWCALSHQERAKCDEWSVSSNGQIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQC
GLVPVMAENYDISSCTNPQSDVFPKGYYAVAVVKASDSSINWNNLKGKKSCHTGVDRTAG
WNIPMGLLFSRINHCKFDEFFSQGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAF
QCLVEKGDVAFVKHQTVLENTNGKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQ
APNHVVVSRKEKAARVSTVLTAQKDLFWKGDKDCTGNFCLFRSSTKDLLFRDDTKCLTKL
PEGTTYEEYLGAEYLQAVGNIRKCSTSRLLEACTFHKS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcgctgtgggtgccctgctggcttgtgccgccctgggactgtgtctggctgtc
cctgacaaaacggtcaaatggtgcgcagtgtctgagcatgagaacaccaagtgtatcagt
ttccgtgaccacatgaaaaccgtccttccagctgatggcccccggcttgcctgtgtgaag
aaaacctcctatcaagattgcatcaaggccatttctggaggtgaagctgatgccattacc
ttggatgggggttgggtgtacgatgcaggcctgactcccaacaacctgaagcctgtggca
gcagagttttatggatcacttgaacatccacagacccactacttggctgtggccgtggtg
aagaagggaacagacttccagctgaaccagctccagggcaagaagtcctgccacactggc
ctgggcaggtctgcaggctggattatccccattggcttacttttctgtaacttgccagag
ccccgcaagcctcttgagaaagctgtggccagtttcttctcgggcagttgtgtcccctgt
gcagatccagtggccttcccccagctgtgtcaactgtgtccaggctgtggctgctccccg
actcaaccgttctttggctacgtaggcgccttcaagtgtctgagagatggaggtggagat
gtggcctttgtcaagcatacaaccatatttgaggtcttgccacagaaggctgacagggat
caatatgagctgctctgccttgacaatacccgcaagccagtggatcagtatgaggactgc
tacctagcccggatcccttctcatgctgttgtggctcgaaatggagatggcaaagaggac
ttgatctgggagatcctcaaagtggctcaggaacactttggcaaaggcaaatcaaaagac
ttccaactgttcggctctcctcttgggaaagacctgctgtttaaggattctgcctttggg
ctgttacgggtgcccccaaggatggactacaggctgtacctcggccacagctatgtcact
gccattcgaaatcagcgggaaggcgtgtgcccggagggctccatcgacagcgcgccagtg
aaatggtgtgcactgagtcaccaagagagagccaagtgtgatgagtggagcgtcagcagc
aatgggcagatagagtgtgagtcagcagagagcactgaggactgcattgacaagattgtg
aatggagaagcagatgccatgagcttggatggaggtcatgcctacatagcaggccagtgt
ggactagtgcccgtcatggcagagaactatgatatctcttcgtgtacaaacccacaatca
gatgtctttcctaaagggtattatgccgtggctgtggtgaaggcatcagactccagcatc
aactggaacaacctgaaaggcaagaagtcctgccatactggagtagacagaaccgccggc
tggaacatccctatgggcctgctgttcagcaggatcaaccactgcaagttcgatgaattt
ttcagtcaaggctgtgctcctggctataagaagaattccaccctctgtgacctgtgtatt
ggcccagcaaaatgtgctccgaacaacagagagggatataatggttatacaggggctttc
cagtgcctcgttgagaagggagacgtagcctttgtgaagcaccagactgtcctggaaaac
acgaacggaaagaacactgctgcatgggctaaggatctgaagcaggaagacttccagctg
ctgtgccctgatggtaccaagaagcctgtaaccgagttcgccacctgccacctggcccaa
gctccaaaccatgttgtggtctcacgaaaagagaaggcagcccgggttagcactgtgctg
actgcccagaaggatttattttggaaaggtgacaaggactgcactggcaatttctgtttg
ttccggtcttccaccaaggaccttctgttcagagatgacaccaagtgtttgactaaactt
ccagaaggtaccacatatgaagagtacttaggagcagagtacttgcaagctgttggaaac
ataaggaagtgttcaacctcacgactcctagaagcctgcactttccacaaaagttaa

DBGET integrated database retrieval system