KEGG   Rattus norvegicus (rat): 24840
Entry
24840             CDS       T01003                                 

Gene name
Tnp2
Definition
(RefSeq) transition protein 2
  KO
K19925  nuclear transition protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24840 (Tnp2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    24840 (Tnp2)
SSDB
Motif
Pfam: TP2
Other DBs
NCBI-GeneID: 24840
NCBI-ProteinID: NP_058753
RGD: 3885
Ensembl: ENSRNOG00000002566
UniProt: P11101 B3LF38
Position
10q11
AA seq 114 aa
MDTKMQSLPTTHPHPHSSSRPQSHTNNQCACSHHCRSCSQAGHPSSSSSPSSGPPTKHPK
TPMHSRYSPSRPSHRGSCPKNRKTLEGKVSKRKAVRRRKRTHRAKRRSSGRRYK
NT seq 345 nt   +upstreamnt  +downstreamnt
atggacaccaagatgcagagccttcccaccactcatccccacccgcacagctcctctcgg
cctcaaagtcacaccaataaccagtgtgcctgcagccaccactgccggagctgcagccaa
gcaggccacccgagctccagttccagccccagctctggcccgccgacgaagcaccccaaa
acacccatgcactctcgttactcaccttcaagacccagccaccgcggcagctgccccaag
aacaggaagaccttggaagggaaagtgagcaagagaaaggcggtcaggaggcggaagcgg
actcacagagctaagaggcgtagctcaggacgaagatacaagtga

DBGET integrated database retrieval system