KEGG   Rattus norvegicus (rat): 24854
Entry
24854             CDS       T01003                                 

Gene name
Clu
Definition
(RefSeq) clusterin precursor
  KO
K17252  clusterin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24854 (Clu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    24854 (Clu)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24854 (Clu)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   24854 (Clu)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24854 (Clu)
SSDB
Motif
Pfam: Clusterin YlqD
Other DBs
NCBI-GeneID: 24854
NCBI-ProteinID: NP_444180
RGD: 3907
Ensembl: ENSRNOG00000016460
UniProt: P05371
Position
15
AA seq 447 aa
MKILLLCVALLLTWDNGMVLGEQEFSDNELQELSTQGSRYVNKEIQNAVQGVKHIKTLIE
KTNAERKSLLNSLEEAKKKKEGALDDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTC
MKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFT
RASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHFLYPKSRLVRSLMPLSHYGPLSFH
NMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQ
CEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQ
LNDQFSWVSQLANLTQGDDQYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEE
VSKDNPKFMDTVAEKALQEYRRKSRME
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaagattctcctgctgtgtgtggcactgctgctgacctgggacaatggcatggtcctg
ggagagcaggagttctctgacaatgagctccaagaactgtccactcaaggaagtaggtat
gttaataaggagattcagaacgccgtccagggggtgaagcacataaagaccctcatagaa
aaaaccaacgcagagcgcaagtccctgctcaacagtttagaggaagccaaaaagaagaaa
gagggtgctctagatgacaccagggattctgaaatgaagctgaaggctttcccggaagtg
tgtaacgagaccatgatggccctctgggaagagtgtaagccctgcctgaagcacacctgc
atgaagttctacgcacgcgtctgcaggagcggctcggggctggttggtcgccagctagag
gagtttctgaaccagagctcacccttctacttctggatgaacggggaccgcatcgactcc
ctgctggagagtgaccggcagcagagccaagtcctagatgctatgcaggacagcttcact
cgggcgtctggcatcatagatacgcttttccaggaccggttcttcacccatgagccccag
gacatccaccatttctcccccatgggcttcccacacaagcggcctcatttcttgtacccc
aagtcccgcttggtccgcagcctcatgcctctctcccactacgggcctctgagcttccac
aacatgttccagcctttctttgatatgatacaccaggctcaacaggccatggacgtccag
ctccatagcccagctttacagttcccggatgtggatttcttaaaagaaggtgaagatgac
cgcacagtgtgcaaggagatccgccataactccacaggatgcctgaagatgaagggccag
tgtgagaagtgccaagagatcttgtctgtggactgttcgaccaacaatcctgcccaggct
aacctgcgccaggagctaaacgactcgctccaggtggctgagaggctgacccagcagtac
aacgagctgcttcattccctccagtccaagatgctcaacacctcatccctgctggaacag
ctgaacgaccagttcagctgggtgtcccagctggctaacctcacacagggcgatgaccag
taccttcgggtctccacagtgacaacccattcttctgactcagaagtcccctctcgtgtc
actgaggtggtggtgaagctgtttgactctgaccccatcacagtggtgttaccagaagaa
gtctccaaggataaccctaagtttatggacacagtggcagagaaagcgctacaggaatac
cgcaggaaaagccgcatggaatga

DBGET integrated database retrieval system