KEGG   Rattus norvegicus (rat): 24855
Entry
24855             CDS       T01003                                 

Gene name
Tsc2
Definition
(RefSeq) tuberin
  KO
K07207  tuberous sclerosis 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04115  p53 signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04218  Cellular senescence
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    24855 (Tsc2)
   04151 PI3K-Akt signaling pathway
    24855 (Tsc2)
   04152 AMPK signaling pathway
    24855 (Tsc2)
   04150 mTOR signaling pathway
    24855 (Tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24855 (Tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    24855 (Tsc2)
   04218 Cellular senescence
    24855 (Tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24855 (Tsc2)
   04919 Thyroid hormone signaling pathway
    24855 (Tsc2)
  09149 Aging
   04211 Longevity regulating pathway
    24855 (Tsc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    24855 (Tsc2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    24855 (Tsc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    24855 (Tsc2)
   05163 Human cytomegalovirus infection
    24855 (Tsc2)
   05165 Human papillomavirus infection
    24855 (Tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24855 (Tsc2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24855 (Tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 24855
NCBI-ProteinID: NP_036812
RGD: 3908
Ensembl: ENSRNOG00000011375
UniProt: P49816
Position
10
AA seq 1809 aa
MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITAEILRELSGECGLNNRIRM
IGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIAPMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
ITLCRTVNVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMENRSYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDI
LLDIIERLLQQLQNLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPE
SSLLNLITYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPLELEERDLAVYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYETLISHIQLHYKH
GYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCAELDRASEKKAS
GPLSPPTGPPSPVPTGPAVRLGHLPYSLLFRVLLQCLKQETDWKVLKLVLSKLPESLRYK
VLIFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDKFRARSTSLNERPKSLRIARAPKQGLNNS
PPVKEFKESCAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGDLQGGSASSSDPGTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
VLDTSAPYTPGGPASLGAQAAPAARPEKPCAGAQLPAAEKANLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAGT
AKPPTLPRSNTVASFSSLYQPSCQGQLHRSVSWADSAVVLEEGSPGEAHVPVEPPELEDF
EAALGTDRHCQRPDAYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPTVDLSFQP
SQPLSKSSSSPELQTLQDILGDLGDKTDIGRLSPEAKVRSQSGILDGEAATWSAPGEESR
ITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRTAASSAEKVPGIN
PSFVFLQLYHSPFCGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSE
LAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAV
FHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHVIITPLDY
KCNLLTLQCRKDMEGLVDTSVAKIVSDRNLSFVARQMALHANMASQVHHRRSNPTDIYPS
KWIARLRHIKRLRQRIREEVHYSNPSLPLMHPPAHTKVPAQAPTEATPTYETGQRKRLIS
SVDDFTEFV
NT seq 5430 nt   +upstreamnt  +downstreamnt
atggccaaaccaactagcaaagattcaggtttgaaggagaagttcaagatactattagga
ctgggaacgtcaaggccaaatcctaggtgtgcagaaggcaaacagacggagtttatcatc
acagcggaaatcttgagagaactgagtggtgaatgcggcctcaacaatcgaatccggatg
atagggcagatctgtgatgtggcaaaaactaagaaacttgaagagcatgcagtggaggca
ctttggaaggctgtctcagacttgctacagccagagcggccaccggaggcccgacatgca
gttctggccttgttgaaggccattgtgcagggacagggtgatcgtttgggggttctccga
gccctcttcttcaaagtgatcaaggactatccttccaacgaagacctccatgaaaggcta
gaggtttttaaggccctcacagacaatggaaggcatattacctacttggaagaagaactg
gcagagtttgtcctgcagtggatggatgttggcttgtcctcagaattccttctggtactc
gtgaacctggtcaagttcaacagctgctaccttgacgaatacattgcgccaatggttcac
atgatttgtctgttatgtatccggacagtgtcctctgtggacatcgaggtgtccttgcaa
gtgctggatgctgtggtctgctacaactgcctgcctgctgagagcctgcctctgttcatt
atcaccctgtgccgcaccgtcaacgtcaaggagctgtgtgagccgtgctggaagctgatg
cgaaaccttctaggtacccatctaggccacagtgccatttacaacatgtgccgtatcatg
gagaacagatcctacatggaagacgcccccttgttgaggggagccgtgttctttgttggg
atggcgctctggggagctcaccgactctattcgctcaagaactcccccacatctgtgctg
ccgtctttttatgaggccatgacctgtcccaatgaggtggtgtcatatgagattgttctg
tccataacaagactcatcaagaagtacaggaaggagctccaggctgtgacatgggacatt
ctgctggacattattgaacgactgctccagcaactccagaacctggacagcccggaactc
aggaccattgtccatgacctgctgaccactgtggaggagctgtgtgaccagaacgagttc
cacggatcgcaagaaagatactatgaactggtggagagctatgcagaccagaggcctgaa
tcctctctcttaaacctgataacctacagagcccagtctatccacccagccaaggatggc
tggatccagaacctgcagttgttgatggagaggttcttcaggaacgagtgccgcagtgcc
gtgcgcatcaaggtgctggacgtcctgtccttcgtgctcctcatcaacaggcagttctac
gaggaggagctgattaactcggtggtcatctcacagctctcccacatccccgaggataaa
gaccatcaggttcgaaagctggctacccagctgctggtggacctggcagagggctgccac
acccaccacttcaacagtctgttggacatcattgaaaaggtgatggctcgctccctttct
ccacccctggagctggaggaaagggatctggctgtgtactcggcctccctggaggatgtg
aagacggcagtcctcgggctcctggtcatccttcagaccaagctgtataccttgcccgcc
agccatgccacacgagtgtatgagacactcattagccacatccagctccattacaagcat
ggctactccttgcccattgctagcagcatccggctgcaggcctttgacttcctgctgcta
ctgcgggctgactcgctgcatcgactgggcctgcccaacaaggatggggtcgtgcgattc
agcccttactgcctctgtgactgcgcggaactggacagggcctcagagaagaaagccagc
ggacccctttcaccgccaactgggccccccagccctgtgccaacgggccctgctgtgagg
ctcggccacctgccctactccctgcttttccgtgtcctgctgcagtgtttgaagcaggag
accgactggaaggtgctgaagctggtgctcagcaaactccctgagtcgctgcgctacaaa
gtcctcattttcacctccccctgcagtgttgaccagctgtcttctgctctctgctccatg
ctttcagccccgaagacccttgagcggctccgaggcaccccagaaggcttctccagaact
gacttgcacttggctgtggtccctgtactgacagcgttaatatcttaccacaactatttg
gataagactagacagcgtgagatggtttactgcctagaacaaggccttatctaccgctgt
gccagccagtgtgtggtagccttggccatctgcagtgtggagatgcccgacatcatcatc
aaggcgctccctgtcctggtggtgaagctgacacacatctctgctacagctagcatggcc
atccccctcctggagttcctgtctaccttggccaggctgcctcacctctacaggaacttc
gccgcagagcagtatgcaagtgtgtttgccatctccttgccctacaccaacccctccaag
ttcaaccagtacattgtgtgtctggcccatcacgtcatagccatgtggttcattaggtgc
cgactgccctttcggaaggattttgtcccttatatcactaagggtctgcgttccaatgtc
ctcctgtcctttgatgatacccctgagaaggacaagttcagagcacggagcaccagtctt
aatgagagacccaaaagtttgaggatagccagagcccccaaacaaggcctgaataactct
ccacctgtgaaagaattcaaagagagctgtgcagccgaggccttccggtgccgcagcatc
agtgtatctgaacatgtggtccgcagcagaatacagacatctcttaccagtgccagcttg
gggtctgcggatgagaactctatggcccaggctgatgacaacctgaagaatctccacttg
gaactcacagaaacatgtctggacatgatggcccgatatgtgttctccaacttcactgcg
gttcccaagaggtcccctgtgggagaattcctcctggcagggggcaggaccaaaacgtgg
ctggttggaaataagctggtcactgtgacaacgagtgtgggaactggtacgcggtcgttg
ctgggcctggactccggggatctgcagggtggctcagcatcaagctctgatcctggcaca
catgtgaggcagacaaaggaagcaccggccaaactggagtcccaggctgggcagcaggtg
tcccgtggggcccgggaccgagtccgctccatgtcagggggccacggccttcgagttggt
gtcctggacacttcagctccctacaccccaggaggccctgcttctctgggagcacaggca
gcaccagcagcaaggcctgagaagccctgtgcaggagcccaacttccggcagcggagaag
gcgaacctggcagcctatgtgcctttgctgacccagggctgggcagagatcctggtccgc
aggcccacaggaaacaccagctggctgatgagcttggagaacccgctcagccccttttcc
tcagacatcaacaacatgcccctgcaagagctgtctaatgcccttatggctgctgagcgc
ttcaaggagcaccgggacacggccctatacaagtcattgtcagtgccagcggctggcaca
gccaagcctcctactctcccacgttctaacacagtggcttctttctcctccctgtaccag
cccagctgccaaggacagctgcacaggagcgtttcctgggcagactcggccgtggttctt
gaggagggaagtccaggagaggctcatgtgccagtggagccccccgaattggaggacttt
gaggcagcattaggtacagacaggcactgccagcggcctgacgcctacagcaggtcttcc
tcagcatctagccaggaagaaaagtcccacttggaggagctggctgcagggggtatcccc
attgagcgggccatctcctctgagggggctcggcctacagtggacctgtccttccaaccc
tcacagcctttgagcaagtctagctcttctcctgagttacagaccttacaggacatcctt
ggagacctaggggacaagactgacattggacggctgagtcctgaggctaaggtccgatcc
cagtcggggatcctggatggggaagcagctacctggtcagctccgggtgaagagagccgt
atcacagtcccacctgaaggtcccctgccttccagttctccccgctcccctagtggcctc
cggccccgaggctataccatctctgattcagctccatcacgaaggggaaagagggtagaa
agggacaacttcaagagcagaactgcggcctccagtgctgaaaaggtgccaggcatcaac
cctagctttgtgttcctacagctctaccattcacccttttgtggtgatgagtccaataag
cccatcctgttgcccaacgagtcctttgaacggtcagtgcagctccttgaccagatccca
tcctatgacactcacaagattgctgtcctgtatgtgggagaaggccagagcagcagtgag
ctggccatcctatcaaatgagcatggctcttataggtacacagagtttctgacaggcctg
ggtcggcttattgagctgaaggactgccaaccagacaaggtgtacttaggtggactggat
gtgtgtggcgaggatggacagttcacgtactgctggcatgatgacatcatgcaagctgtt
ttccacattgctaccctgatgcccaccaaggatgtggacaagcaccgttgtgacaagaaa
cggcacctgggcaatgactttgtttctatcatctacaatgattctggtgaggacttcaag
ctgggcaccattaagggccagttcaacttcgtccatgtgatcatcacaccgctggactat
aaatgcaacctgttgaccctgcagtgcaggaaagacatggagggccttgtggacaccagt
gtggccaagattgtgtctgaccgcaacctgtcctttgtggcccgacagatggccctgcat
gcaaatatggcctcacaggtacaccacaggcgatccaaccccacggacatctatccctcc
aagtggatcgcaagactccgccacattaagcgtctccgtcagcggatccgtgaagaagtg
cactattcaaacccaagcttgcctctgatgcaccctccagcccataccaaagtcccagct
caagcccctacggaggctacacccacctacgagacaggccagcggaaacgcctcatttcc
tctgtggatgacttcacagagtttgtgtga

DBGET integrated database retrieval system