KEGG   Rattus norvegicus (rat): 24860
Entry
24860             CDS       T01003                                 

Gene name
Ucp1, Ucp, Ucpa, Uncp
Definition
(RefSeq) uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04371  Apelin signaling pathway
rno04714  Thermogenesis
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    24860 (Ucp1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    24860 (Ucp1)
  09159 Environmental adaptation
   04714 Thermogenesis
    24860 (Ucp1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    24860 (Ucp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24860 (Ucp1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   24860 (Ucp1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 24860
NCBI-ProteinID: NP_036814
RGD: 3931
Ensembl: ENSRNOG00000003580
UniProt: P04633
Position
19q11
AA seq 307 aa
MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLG
TITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAG
LMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPN
LMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRF
INSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSR
QTVDCTT
NT seq 924 nt   +upstreamnt  +downstreamnt
atggtgagttcgacaacttccgaagtgcaacccaccatgggggtcaagatcttctcagcc
ggcgtttctgcctgcctagcagacatcatcaccttcccgctggacaccgccaaagtccgc
cttcagatccaaggtgaaggccaggcttccagtactattaggtataaaggtgtcttaggg
accatcaccaccctggccaagacagaaggattgccgaaactgtacagcggtctgcctgct
ggcatccagaggcaaatcagctttgcttccctcaggattggcctctacgatacggtccaa
gagtacttctcttcagggagagaaacgcctgcctctttgggaagcaagatctcggctggc
ttgatgacgggtggcgtggcggtattcattgggcagcccacagaggtggtgaaggtcaga
atgcaagcacaaagccatctgcacgggatcaaaccccgctacactgggacctacaatgct
tacagagttatagccaccacagaaagcttgtcaacactgtggaaagggacgactcctaat
ctaatgagaaatgtcatcatcaactgtacagagctggtgacatatgacctcatgaagggg
gcccttgtgaaccaccacatactggcagatgacgtcccctgccatttactgtcagctctt
gtcgccgggttttgcaccacactcctggcctctccggtggatgtggtaaaaacgagattc
atcaactctctaccaggacagtacccaagtgtacccagctgtgcaatgaccatgtacacc
aaggaaggaccggcagcctttttcaaagggtttgcgccttcttttctgcgactcggatcc
tggaacgtcatcatgtttgtgtgctttgaacagctgaagaaagagctgatgaagtcccgg
cagacagtggactgcaccacatag

DBGET integrated database retrieval system