KEGG   Rattus norvegicus (rat): 24873Help
Entry
24873             CDS       T01003                                 

Gene name
Vdr, Nr1i1
Definition
(RefSeq) vitamin D (1,25- dihydroxyvitamin D3) receptor
  KO
K08539  vitamin D3 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04978  Mineral absorption
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    24873 (Vdr)
  09154 Digestive system
   04978 Mineral absorption
    24873 (Vdr)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24873 (Vdr)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    24873 (Vdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rno01009]
    24873 (Vdr)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24873 (Vdr)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24873 (Vdr)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24873 (Vdr)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    24873 (Vdr)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   24873 (Vdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Motif
Other DBs
NCBI-GeneID: 24873
NCBI-ProteinID: NP_058754
RGD: 3959
Ensembl: ENSRNOG00000054420
UniProt: P13053
Structure
PDB: 

Position
7q36
AA seq 423 aa AA seqDB search
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaacagcggccagcacctccctgcccgaccctggtgactttgaccggaacgtg
ccccggatctgtggagtgtgtggagaccgagccacaggcttccacttcaatgctatgacc
tgtgaaggctgcaaaggtttcttcaggcggagcatgaagcggaaggccctgttcacctgt
cccttcaatggagattgccgcatcaccaaggacaaccggcgacactgccaggcctgccgg
ctcaaacgctgtgtggacatcggcatgatgaaggagttcatcctgacagatgaggaggta
cagcgtaagagggagatgataatgaagagaaaagaggaagaggccttgaaggacagtctg
aggcccaagctatctgaagaacaacagcacatcatagccatcctgctggacgcccaccac
aagacctatgaccccacctacgctgacttcagggacttccggcctccagttcgtatggac
ggaagtacagggagctattctccaaggcccacactcagcttctccgggaactcctcctcc
tccagctctgacctgtacaccacctcactagacatgatggaaccatccggcttttccaac
ctggatctgaacggagaggattctgatgacccgtctgtgactctggacctgtctcctctc
tccatgctgccccacctggctgaccttgtcagttacagcatccaaaaggtcatcggcttt
gccaagatgatcccaggattcagggatctcacctccgatgaccagattgtcctgcttaag
tcaagcgccattgaggtgatcatgttacgctccaaccagtctttcaccatggatgatatg
tcctgggactgtggcagccaggactacaagtacgacgtcaccgatgtctccaaagctggg
cacaccctggagctgatcgagcccctcataaagttccaggtggggctgaagaagctgaac
ttacatgaggaagagcatgtccttctcatggccatctgcattgtctccccggaccgacct
ggggtccaggacgccaagctggtggaagccattcaggaccgcctatccaacacgctgcag
acctacatccgctgccgccacccgcccccaggcagccaccagctctatgccaagatgatc
cagaaactggccgacctgcggagcctcaacgaggaacactccaaacaataccgctccctc
tccttccagcccgagaatagcatgaagctcacaccccttgtgctggaggtgttcggcaat
gagatctcctga

DBGET integrated database retrieval system