KEGG   Rattus norvegicus (rat): 24874
Entry
24874             CDS       T01003                                 

Gene name
Vhl
Definition
(RefSeq) von Hippel-Lindau disease tumor suppressor
  KO
K03871  von Hippel-Lindau disease tumor supressor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    24874 (Vhl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24874 (Vhl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24874 (Vhl)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    24874 (Vhl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    24874 (Vhl)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     24874 (Vhl)
SSDB
Motif
Pfam: VHL VHL_C Arm_vescicular
Other DBs
NCBI-GeneID: 24874
NCBI-ProteinID: NP_434688
RGD: 3960
Ensembl: ENSRNOG00000010258
UniProt: Q64259
Position
4
AA seq 185 aa
MPRKAASPEEAERMPGSEEIEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGE
PQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLP
VYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVRKDIQRLTQEHLENQALGEE
PEGVH
NT seq 558 nt   +upstreamnt  +downstreamnt
atgccccggaaggcagctagtccagaggaggcagaaaggatgccgggctctgaagagata
gaggctgggcggccgcggccggttttacgctctgtgaactcgcgcgaaccctctcaggtc
atcttctgcaaccgcagcccgcgcgtcgtgctgcctttgtggctcaactttgatggtgag
cctcagccctacccgaccttaccaccgggcaccggccgccgcatccacagctaccgaggt
cacctttggctcttcagggatgcggggacccatgatggacttctggttaaccaaacggaa
ctgtttgtgccatccctcaatgttgatggacagcctatttttgccaacatcacattgcca
gtgtataccctgaaagagcggtgccttcaggttgtacggagcctggtcaagcctgagaac
tacaggaggctggacatcgtcaggtcgctctatgaagacttggaagaccacccaaatgtg
cggaaagacatacagcggctgacccaagagcacctcgagaatcaggccctgggagaggag
cctgaaggagtccactga

DBGET integrated database retrieval system